+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=Antarctica/Troll
+ echo 'Chosen random timezone Antarctica/Troll'
+ ln -snf /usr/share/zoneinfo/Antarctica/Troll /etc/localtime
Chosen random timezone Antarctica/Troll
+ echo Antarctica/Troll
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48426 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10527.altinitytest) ...
Setting up clickhouse-common-static (24.8.14.10527.altinitytest) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48453 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10527.altinitytest) ...
Setting up clickhouse-common-static-dbg (24.8.14.10527.altinitytest) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48460 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10527.altinitytest) ...
Setting up clickhouse-odbc-bridge (24.8.14.10527.altinitytest) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48466 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10527.altinitytest) ...
Setting up clickhouse-library-bridge (24.8.14.10527.altinitytest) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48472 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10527.altinitytest) ...
Setting up clickhouse-server (24.8.14.10527.altinitytest) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10527.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48489 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10527.altinitytest_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10527.altinitytest) ...
Setting up clickhouse-client (24.8.14.10527.altinitytest) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10527.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=1
+ sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=27633664
+ sed --follow-symlinks -i 's|[[:digit:]]\+|27633664|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=47384576
+ sed --follow-symlinks -i 's|[[:digit:]]\+|47384576|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ ./minio server --address :11111 ./minio_data
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:44963 http://127.0.0.1:44963
Docs: https://min.io/docs/minio/linux/index.html
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./18953E1BE1CC36357dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 295 root 8u IPv6 34355 0t0 TCP *:11111 (LISTEN)
minio 295 root 9u IPv4 34354 0t0 TCP localhost:11111 (LISTEN)
minio 295 root 10u IPv6 34356 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 78.17 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Feb 18 04:51 .
drwxr-xr-x 1 root root 4.0K Feb 18 04:51 ..
-rw-rw-r-- 1 1000 1000 119 Feb 18 04:45 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Feb 18 04:51 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Feb 18 04:51 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Feb 18 04:51 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Feb 18 04:51 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 18 04:45 broken_tests.json
drwxr-xr-x 14 root root 3.8K Feb 18 04:50 dev
-rwxr-xr-x 1 root root 0 Feb 18 04:50 .dockerenv
drwxr-xr-x 1 root root 4.0K Feb 18 04:51 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jan 31 2025 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jan 31 2025 minio
drwxr-xr-x 4 root root 4.0K Feb 18 04:52 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Feb 18 04:50 package_folder
dr-xr-xr-x 310 root root 0 Feb 18 04:50 proc
-rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
drwx------ 1 root root 4.0K Feb 18 04:52 root
drwxr-xr-x 1 root root 4.0K Feb 18 04:51 run
-rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 18 04:50 sys
drwxrwxr-x 2 1000 1000 4.0K Feb 18 04:50 test_output
drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 423 clickhouse 322u IPv4 30376 0t0 TCP localhost:12222 (LISTEN)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "PUT /devstoreaccount1/cont/nhqjnxpcxeybylqvrvkzjzakyhamlnxg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "GET /devstoreaccount1/cont/nhqjnxpcxeybylqvrvkzjzakyhamlnxg HTTP/1.1" 206 4
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "GET /devstoreaccount1/cont/nhqjnxpcxeybylqvrvkzjzakyhamlnxg HTTP/1.1" 206 2
127.0.0.1 - - [18/Feb/2026:04:52:17 +0000] "DELETE /devstoreaccount1/cont/nhqjnxpcxeybylqvrvkzjzakyhamlnxg HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=0
+ [[ 0 = \1 ]]
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
info registers
p top' 1 KiB of the 'stack:
p/x *(uint64_t[128]*)$sp
maintenance info sections
thread apply all backtrace full
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 619
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
clickminio restart attempt 1:
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:41007 http://127.0.0.1:41007
Docs: https://min.io/docs/minio/linux/index.html
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
+ echo 'Restarted clickminio successfully.'
+ break
Output of restart status: success
success
Restarted clickminio successfully.
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1511
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 0 ]]
+ [[ -n 2 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats
+ tee -a test_output/test_result.txt
+ ts '%Y-%m-%d %H:%M:%S'
2026-02-18 04:52:51 Using queries from '/usr/share/clickhouse-test/queries' directory
2026-02-18 04:52:51 Connecting to ClickHouse server... OK
2026-02-18 04:52:51 Connected to server 24.8.14.10527.altinitytest @ fd36ebaf95d0d6fb496d11b3a9553b4fae0f711a HEAD
2026-02-18 04:52:52 Found 3254 parallel tests and 282 sequential tests
2026-02-18 04:52:52 Running about 406 stateless tests (Process-8).
2026-02-18 04:52:52 01359_geodistance_loop: [ OK ] 0.53 sec.
2026-02-18 04:52:52 Running about 406 stateless tests (Process-5).
2026-02-18 04:52:52 02990_format_not_precedence: [ OK ] 0.73 sec.
2026-02-18 04:52:53 Running about 406 stateless tests (Process-10).
2026-02-18 04:52:53 00063_check_query: [ OK ] 0.88 sec.
2026-02-18 04:52:53 Running about 406 stateless tests (Process-6).
2026-02-18 04:52:53 02366_kql_operator_in_sql: [ OK ] 0.93 sec.
2026-02-18 04:52:53 01250_fixed_string_comparison: [ OK ] 0.68 sec.
2026-02-18 04:52:53 03007_column_nullable_uninitialzed_value: [ OK ] 0.63 sec.
2026-02-18 04:52:54 Running about 406 stateless tests (Process-4).
2026-02-18 04:52:54 02907_clickhouse_dictionary_bug: [ OK ] 1.94 sec.
2026-02-18 04:52:54 01925_jit_aggregation_function_count_long: [ OK ] 0.73 sec.
2026-02-18 04:52:55 Running about 406 stateless tests (Process-9).
2026-02-18 04:52:55 02360_send_logs_level_colors: [ OK ] 2.84 sec.
2026-02-18 04:52:55 03273_dynamic_pretty_json_serialization: [ OK ] 0.68 sec.
2026-02-18 04:52:55 02354_vector_search_legacy_index_compatibility: [ OK ] 0.98 sec.
2026-02-18 04:52:55 01049_zookeeper_synchronous_mutations_long: [ OK ] 1.58 sec.
2026-02-18 04:52:55 01276_system_licenses: [ OK ] 0.73 sec.
2026-02-18 04:52:55 01614_with_fill_with_limit: [ OK ] 0.68 sec.
2026-02-18 04:52:56 01213_alter_table_rename_nested: [ OK ] 0.98 sec.
2026-02-18 04:52:58 00818_alias_bug_4110: [ OK ] 2.49 sec.
2026-02-18 04:52:58 02380_insert_mv_race: [ OK ] 5.25 sec.
2026-02-18 04:52:58 02841_not_ready_set_constraints: [ OK ] 2.58 sec.
2026-02-18 04:52:58 00275_shard_quantiles_weighted: [ OK ] 3.03 sec.
2026-02-18 04:52:58 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 2.36 sec.
2026-02-18 04:52:59 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.73 sec.
2026-02-18 04:52:59 02383_schema_inference_hints: [ OK ] 0.78 sec.
2026-02-18 04:52:59 02713_sequence_match_serialization_fix: [ OK ] 0.78 sec.
2026-02-18 04:52:59 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 1.08 sec.
2026-02-18 04:52:59 00073_merge_sorting_empty_array_joined: [ OK ] 0.68 sec.
2026-02-18 04:52:59 Running about 406 stateless tests (Process-3).
2026-02-18 04:52:59 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 7.76 sec.
2026-02-18 04:53:00 00129_quantile_timing_weighted: [ OK ] 0.68 sec.
2026-02-18 04:53:00 02160_special_functions: [ OK ] 1.13 sec.
2026-02-18 04:53:00 02861_interpolate_alias_precedence: [ OK ] 0.83 sec.
2026-02-18 04:53:00 01525_select_with_offset_fetch_clause: [ OK ] 0.68 sec.
2026-02-18 04:53:00 02867_null_lc_in_bug: [ OK ] 0.93 sec.
2026-02-18 04:53:01 03018_external_with_complex_data_types: [ OK ] 1.78 sec.
2026-02-18 04:53:01 02842_suggest_http_page_in_error_message: [ OK ] 1.33 sec.
2026-02-18 04:53:02 02884_parquet_new_encodings: [ OK ] 1.53 sec.
2026-02-18 04:53:02 01880_remote_ipv6: [ OK ] 1.03 sec.
2026-02-18 04:53:03 02771_ignore_data_skipping_indices: [ OK ] 0.98 sec.
2026-02-18 04:53:03 Running about 406 stateless tests (Process-7).
2026-02-18 04:53:03 01825_new_type_json_multiple_files: [ OK ] 11.42 sec.
2026-02-18 04:53:04 01079_new_range_reader_segfault: [ OK ] 0.73 sec.
2026-02-18 04:53:04 02751_text_formats_bad_nullable_parsing: [ OK ] 5.95 sec.
2026-02-18 04:53:04 01600_quota_by_forwarded_ip: [ OK ] 2.83 sec.
2026-02-18 04:53:04 00825_protobuf_format_squares: [ OK ] 4.49 sec.
2026-02-18 04:53:04 02301_harmful_reexec: [ OK ] 1.88 sec.
2026-02-18 04:53:05 02551_ipv4_implicit_uint64: [ OK ] 0.69 sec.
2026-02-18 04:53:05 01795_TinyLog_rwlock_ub: [ OK ] 0.78 sec.
2026-02-18 04:53:05 01540_verbatim_partition_pruning: [ OK ] 0.98 sec.
2026-02-18 04:53:05 02421_json_decimals_as_strings: [ OK ] 0.73 sec.
2026-02-18 04:53:06 01746_extract_text_from_html: [ OK ] 1.33 sec.
2026-02-18 04:53:06 01600_multiple_left_join_with_aliases: [ OK ] 0.78 sec.
2026-02-18 04:53:06 01926_order_by_desc_limit: [ OK ] 5.71 sec.
2026-02-18 04:53:06 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 1.03 sec.
2026-02-18 04:53:07 02121_pager: [ OK ] 2.14 sec.
2026-02-18 04:53:07 01626_cnf_test: [ OK ] 0.93 sec.
2026-02-18 04:53:07 02949_ttl_group_by_bug: [ OK ] 0.83 sec.
2026-02-18 04:53:07 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec.
2026-02-18 04:53:07 Reason: not running for current build
2026-02-18 04:53:07 02016_aggregation_spark_bar: [ OK ] 1.68 sec.
2026-02-18 04:53:08 02791_final_block_structure_mismatch_bug: [ OK ] 1.39 sec.
2026-02-18 04:53:08 01746_forbid_drop_column_referenced_by_mv: [ OK ] 1.33 sec.
2026-02-18 04:53:08 00800_low_cardinality_empty_array: [ OK ] 0.73 sec.
2026-02-18 04:53:08 02770_jit_aggregation_nullable_key_fix: [ OK ] 1.48 sec.
2026-02-18 04:53:08 00936_function_result_with_operator_in: [ OK ] 1.13 sec.
2026-02-18 04:53:09 01545_url_file_format_settings: [ OK ] 0.82 sec.
2026-02-18 04:53:09 03197_storage_join_strictness_type_restriction: [ OK ] 0.83 sec.
2026-02-18 04:53:09 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.68 sec.
2026-02-18 04:53:09 01463_resample_overflow: [ OK ] 0.68 sec.
2026-02-18 04:53:09 01392_column_resolve: [ OK ] 0.68 sec.
2026-02-18 04:53:09 00719_insert_block_without_column: [ OK ] 4.39 sec.
2026-02-18 04:53:09 01083_aggregation_memory_efficient_bug: [ OK ] 0.93 sec.
2026-02-18 04:53:10 00712_prewhere_with_alias_bug: [ OK ] 0.68 sec.
2026-02-18 04:53:10 00723_remerge_sort: [ OK ] 1.03 sec.
2026-02-18 04:53:10 02916_distributed_skip_unavailable_shards: [ OK ] 0.73 sec.
2026-02-18 04:53:10 02165_h3_edge_length_km: [ OK ] 0.78 sec.
2026-02-18 04:53:11 02131_skip_index_not_materialized: [ OK ] 0.83 sec.
2026-02-18 04:53:11 00467_qualified_names: [ OK ] 0.87 sec.
2026-02-18 04:53:11 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 1.23 sec.
2026-02-18 04:53:11 02022_storage_filelog_one_file: [ OK ] 8.42 sec.
2026-02-18 04:53:12 01663_test_toDate_mysql_compatibility: [ OK ] 0.64 sec.
2026-02-18 04:53:12 01922_array_join_with_index: [ OK ] 0.73 sec.
2026-02-18 04:53:12 02972_to_string_nullable_timezone: [ OK ] 0.73 sec.
2026-02-18 04:53:12 03130_analyzer_self_join_group_by: [ OK ] 0.93 sec.
2026-02-18 04:53:13 02515_projections_with_totals: [ OK ] 0.67 sec.
2026-02-18 04:53:13 02950_reading_array_tuple_subcolumns: [ OK ] 1.34 sec.
2026-02-18 04:53:13 02184_ipv6_cast_test: [ OK ] 0.77 sec.
2026-02-18 04:53:14 01825_type_json_3: [ OK ] 1.33 sec.
2026-02-18 04:53:14 03214_count_distinct_null_key_memory_leak: [ OK ] 4.14 sec.
2026-02-18 04:53:14 01188_attach_table_from_path: [ OK ] 0.93 sec.
2026-02-18 04:53:14 02901_analyzer_recursive_window: [ OK ] 0.78 sec.
2026-02-18 04:53:14 01610_client_spawn_editor: [ OK ] 0.28 sec.
2026-02-18 04:53:14 00580_cast_nullable_to_non_nullable: [ OK ] 0.78 sec.
2026-02-18 04:53:15 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 2.54 sec.
2026-02-18 04:53:16 02540_duplicate_primary_key2: [ OK ] 0.73 sec.
2026-02-18 04:53:16 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 6.95 sec.
2026-02-18 04:53:17 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.98 sec.
2026-02-18 04:53:17 01710_projection_array_join: [ OK ] 0.78 sec.
2026-02-18 04:53:18 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 3.49 sec.
2026-02-18 04:53:18 02860_distributed_flush_on_detach: [ OK ] 0.83 sec.
2026-02-18 04:53:19 02456_keeper_retries_during_insert: [ OK ] 2.29 sec.
2026-02-18 04:53:19 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 1.28 sec.
2026-02-18 04:53:20 02429_low_cardinality_trash: [ OK ] 1.29 sec.
2026-02-18 04:53:20 01375_null_issue_3767: [ OK ] 0.73 sec.
2026-02-18 04:53:20 01560_optimize_on_insert_zookeeper: [ OK ] 1.28 sec.
2026-02-18 04:53:20 02735_system_zookeeper_connection: [ OK ] 0.83 sec.
2026-02-18 04:53:21 00389_concat_operator: [ OK ] 0.63 sec.
2026-02-18 04:53:21 02354_vector_search_detach_attach: [ OK ] 0.73 sec.
2026-02-18 04:53:22 00847_multiple_join_same_column: [ OK ] 1.04 sec.
2026-02-18 04:53:22 00725_join_on_bug_2: [ OK ] 0.88 sec.
2026-02-18 04:53:22 01358_lc_parquet: [ OK ] 13.18 sec.
2026-02-18 04:53:22 02383_arrow_dict_special_cases: [ OK ] 7.55 sec.
2026-02-18 04:53:22 01416_join_totals_header_bug: [ OK ] 0.78 sec.
2026-02-18 04:53:23 03003_compatibility_setting_bad_value: [ OK ] 0.63 sec.
2026-02-18 04:53:23 02097_polygon_dictionary_store_key: [ OK ] 0.83 sec.
2026-02-18 04:53:23 00878_join_unexpected_results: [ OK ] 1.38 sec.
2026-02-18 04:53:24 02381_compress_marks_and_primary_key: [ OK ] 3.04 sec.
2026-02-18 04:53:24 02233_HTTP_ranged: [ OK ] 1.93 sec.
2026-02-18 04:53:24 02337_join_analyze_stuck: [ OK ] 1.14 sec.
2026-02-18 04:53:24 00831_quantile_weighted_parameter_check: [ OK ] 0.68 sec.
2026-02-18 04:53:24 00577_full_join_segfault: [ OK ] 0.73 sec.
2026-02-18 04:53:24 02354_vector_search_queries: [ OK ] 0.93 sec.
2026-02-18 04:53:25 03208_inconsistent_formatting_of_not_subquery: [ OK ] 1.18 sec.
2026-02-18 04:53:25 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.83 sec.
2026-02-18 04:53:25 02556_local_with_totals_and_extremes: [ OK ] 1.33 sec.
2026-02-18 04:53:26 00700_decimal_empty_aggregates: [ OK ] 1.93 sec.
2026-02-18 04:53:26 00059_shard_global_in_mergetree: [ OK ] 1.08 sec.
2026-02-18 04:53:26 02982_comments_in_system_tables: [ OK ] 2.08 sec.
2026-02-18 04:53:27 02891_functions_over_sparse_columns: [ OK ] 0.93 sec.
2026-02-18 04:53:27 02790_client_max_opening_fd: [ OK ] 1.78 sec.
2026-02-18 04:53:27 02481_default_value_used_in_row_level_filter: [ OK ] 0.83 sec.
2026-02-18 04:53:27 01866_bit_positions_to_array: [ OK ] 0.98 sec.
2026-02-18 04:53:28 00022_func_higher_order_and_constants: [ OK ] 0.68 sec.
2026-02-18 04:53:29 00700_to_decimal_or_something: [ OK ] 1.48 sec.
2026-02-18 04:53:29 01943_query_id_check: [ OK ] 1.68 sec.
2026-02-18 04:53:30 02962_analyzer_constant_set: [ OK ] 0.73 sec.
2026-02-18 04:53:31 00623_in_partition_key: [ OK ] 1.53 sec.
2026-02-18 04:53:31 02478_analyzer_table_expression_aliases: [ OK ] 1.08 sec.
2026-02-18 04:53:31 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 4.84 sec.
2026-02-18 04:53:32 01043_categorical_iv: [ OK ] 1.08 sec.
2026-02-18 04:53:32 01278_format_multiple_queries: [ OK ] 1.23 sec.
2026-02-18 04:53:32 01906_partition_by_multiply_by_zero: [ OK ] 0.73 sec.
2026-02-18 04:53:33 02225_hints_for_indeices: [ OK ] 4.64 sec.
2026-02-18 04:53:33 02811_insert_schema_inference: [ OK ] 0.78 sec.
2026-02-18 04:53:33 00080_show_tables_and_system_tables: [ OK ] 0.93 sec.
2026-02-18 04:53:34 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.73 sec.
2026-02-18 04:53:34 02525_different_engines_in_temporary_tables: [ OK ] 1.03 sec.
2026-02-18 04:53:34 02969_analyzer_eliminate_injective_functions: [ OK ] 0.84 sec.
2026-02-18 04:53:34 00484_preferred_max_column_in_block_size_bytes: [ OK ] 2.13 sec.
2026-02-18 04:53:34 01292_quantile_array_bug: [ OK ] 0.63 sec.
2026-02-18 04:53:35 02497_if_transform_strings_to_enum: [ OK ] 1.18 sec.
2026-02-18 04:53:35 03094_one_thousand_joins: [ OK ] 20.47 sec.
2026-02-18 04:53:35 02482_execute_functions_before_sorting_bug: [ OK ] 0.78 sec.
2026-02-18 04:53:36 02973_dictionary_table_exception_fix: [ OK ] 0.82 sec.
2026-02-18 04:53:36 00055_join_two_numbers: [ OK ] 0.88 sec.
2026-02-18 04:53:36 02876_yyyymmddhhmmsstodatetime: [ OK ] 2.03 sec.
2026-02-18 04:53:37 00974_adaptive_granularity_secondary_index: [ OK ] 1.73 sec.
2026-02-18 04:53:37 00938_fix_rwlock_segfault_long: [ SKIPPED ] 0.00 sec.
2026-02-18 04:53:37 Reason: not running for current build
2026-02-18 04:53:37 02241_short_circuit_short_column: [ OK ] 0.88 sec.
2026-02-18 04:53:37 02884_duplicate_index_name: [ OK ] 0.68 sec.
2026-02-18 04:53:38 02834_array_exists_segfault: [ OK ] 0.78 sec.
2026-02-18 04:53:38 02124_insert_deduplication_token_replica: [ OK ] 1.43 sec.
2026-02-18 04:53:38 01300_wkt: [ OK ] 1.04 sec.
2026-02-18 04:53:38 01187_set_profile_as_setting: [ OK ] 2.43 sec.
2026-02-18 04:53:38 02151_lc_prefetch: [ SKIPPED ] 0.00 sec.
2026-02-18 04:53:38 Reason: not running for current build
2026-02-18 04:53:39 00725_join_on_bug_1: [ OK ] 0.88 sec.
2026-02-18 04:53:39 00320_between: [ OK ] 0.73 sec.
2026-02-18 04:53:39 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.83 sec.
2026-02-18 04:53:39 02990_arrayFold_nullable_lc: [ OK ] 1.18 sec.
2026-02-18 04:53:40 03084_analyzer_join_column_alias: [ OK ] 0.93 sec.
2026-02-18 04:53:40 03002_modify_query_cte: [ OK ] 0.63 sec.
2026-02-18 04:53:40 00521_multidimensional: [ OK ] 1.33 sec.
2026-02-18 04:53:40 02010_array_index_bad_cast: [ OK ] 0.83 sec.
2026-02-18 04:53:41 02479_nullable_primary_key_non_first_column: [ OK ] 0.77 sec.
2026-02-18 04:53:41 00151_tuple_with_array: [ OK ] 0.68 sec.
2026-02-18 04:53:41 03199_join_with_materialized_column: [ OK ] 0.72 sec.
2026-02-18 04:53:42 02124_insert_deduplication_token: [ OK ] 0.88 sec.
2026-02-18 04:53:42 01804_uniq_up_to_ubsan: [ OK ] 0.73 sec.
2026-02-18 04:53:43 01560_crash_in_agg_empty_arglist: [ OK ] 1.48 sec.
2026-02-18 04:53:43 02833_local_udf_options: [ OK ] 1.53 sec.
2026-02-18 04:53:44 02968_full_sorting_join_fuzz: [ OK ] 10.01 sec.
2026-02-18 04:53:44 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.93 sec.
2026-02-18 04:53:45 02267_file_globs_schema_inference: [ OK ] 5.75 sec.
2026-02-18 04:53:45 00746_hashing_tuples: [ OK ] 0.92 sec.
2026-02-18 04:53:45 00273_quantiles: [ OK ] 1.28 sec.
2026-02-18 04:53:45 00719_parallel_ddl_db: [ OK ] 31.61 sec.
2026-02-18 04:53:45 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.83 sec.
2026-02-18 04:53:45 02421_truncate_isolation_no_merges: [ OK ] 53.17 sec.
2026-02-18 04:53:46 01036_union_different_columns: [ OK ] 0.68 sec.
2026-02-18 04:53:46 02184_storage_add_support_ttl: [ OK ] 0.98 sec.
2026-02-18 04:53:46 00609_distributed_with_case_when_then: [ OK ] 0.88 sec.
2026-02-18 04:53:47 01051_new_any_join_engine: [ OK ] 1.29 sec.
2026-02-18 04:53:47 00679_replace_asterisk: [ OK ] 0.73 sec.
2026-02-18 04:53:47 02345_analyzer_subqueries: [ OK ] 1.02 sec.
2026-02-18 04:53:48 02313_test_fpc_codec: [ OK ] 1.38 sec.
2026-02-18 04:53:48 02963_test_flexible_disk_configuration: [ OK ] 1.68 sec.
2026-02-18 04:53:48 01657_array_element_ubsan: [ OK ] 0.93 sec.
2026-02-18 04:53:49 02029_quantile_sanitizer: [ OK ] 0.68 sec.
2026-02-18 04:53:49 03037_dot_product_overflow: [ OK ] 0.58 sec.
2026-02-18 04:53:50 02364_window_case: [ OK ] 0.68 sec.
2026-02-18 04:53:50 00251_has_types: [ OK ] 0.74 sec.
2026-02-18 04:53:50 03135_keeper_client_find_commands: [ OK ] 2.34 sec.
2026-02-18 04:53:51 00386_long_in_pk: [ OK ] 26.04 sec.
2026-02-18 04:53:51 01917_system_data_skipping_indices: [ OK ] 0.93 sec.
2026-02-18 04:53:52 01531_query_log_query_comment: [ OK ] 2.03 sec.
2026-02-18 04:53:52 00763_create_query_as_table_engine_bug: [ OK ] 0.73 sec.
2026-02-18 04:53:52 01034_with_fill_and_push_down_predicate: [ OK ] 0.63 sec.
2026-02-18 04:53:53 01043_h3_edge_length_m: [ OK ] 0.58 sec.
2026-02-18 04:53:53 01529_bad_memory_tracking: [ OK ] 7.16 sec.
2026-02-18 04:53:53 02242_throw_if_constant_argument: [ OK ] 0.68 sec.
2026-02-18 04:53:53 02125_lz4_compression_bug_Values: [ OK ] 12.18 sec.
2026-02-18 04:53:53 00482_subqueries_and_aliases: [ OK ] 0.73 sec.
2026-02-18 04:53:53 02912_group_array_sample: [ OK ] 0.68 sec.
2026-02-18 04:53:54 02476_fuse_sum_count: [ OK ] 1.23 sec.
2026-02-18 04:53:54 02381_analyzer_join_final: [ OK ] 0.73 sec.
2026-02-18 04:53:54 03230_anyHeavy_merge: [ OK ] 0.73 sec.
2026-02-18 04:53:54 01102_distributed_local_in_bug: [ OK ] 0.93 sec.
2026-02-18 04:53:55 02575_merge_prewhere_default_expression: [ OK ] 0.73 sec.
2026-02-18 04:53:55 00967_insert_into_distributed_different_types: [ OK ] 0.83 sec.
2026-02-18 04:53:55 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.78 sec.
2026-02-18 04:53:56 02581_width_bucket: [ OK ] 1.53 sec.
2026-02-18 04:53:56 01550_query_identifier_parameters: [ OK ] 4.39 sec.
2026-02-18 04:53:56 02999_scalar_subqueries_bug_2: [ OK ] 0.73 sec.
2026-02-18 04:53:56 02896_cyclic_aliases_crash: [ OK ] 0.78 sec.
2026-02-18 04:53:57 00803_odbc_driver_2_format: [ OK ] 0.78 sec.
2026-02-18 04:53:57 02890_partition_prune_in_extra_columns: [ OK ] 0.78 sec.
2026-02-18 04:53:57 02353_translate: [ OK ] 1.03 sec.
2026-02-18 04:53:57 01323_add_scalars_in_time: [ OK ] 1.08 sec.
2026-02-18 04:53:58 00955_complex_prepared_statements: [ OK ] 7.95 sec.
2026-02-18 04:53:58 01678_great_circle_angle: [ OK ] 0.73 sec.
2026-02-18 04:53:59 02344_distinct_limit_distiributed: [ OK ] 1.68 sec.
2026-02-18 04:53:59 01550_create_map_type: [ OK ] 1.99 sec.
2026-02-18 04:53:59 02708_dotProduct: [ OK ] 1.38 sec.
2026-02-18 04:53:59 01961_roaring_memory_tracking: [ OK ] 4.64 sec.
2026-02-18 04:53:59 02725_object_column_alter: [ OK ] 0.69 sec.
2026-02-18 04:53:59 03001_block_offset_column_2: [ OK ] 0.99 sec.
2026-02-18 04:54:00 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.98 sec.
2026-02-18 04:54:00 01071_force_optimize_skip_unused_shards: [ OK ] 1.30 sec.
2026-02-18 04:54:00 01442_merge_detach_attach_long: [ SKIPPED ] 0.00 sec.
2026-02-18 04:54:00 Reason: not running for current build
2026-02-18 04:54:00 01851_clear_column_referenced_by_mv: [ OK ] 0.77 sec.
2026-02-18 04:54:01 00396_uuid: [ OK ] 0.88 sec.
2026-02-18 04:54:01 02477_age_date32: [ OK ] 1.63 sec.
2026-02-18 04:54:02 02731_replace_partition_from_temporary_table: [ OK ] 1.68 sec.
2026-02-18 04:54:09 02504_regexp_dictionary_ua_parser: [ OK ] 7.01 sec.
2026-02-18 04:54:10 01702_system_numbers_scientific_notation: [ OK ] 0.77 sec.
2026-02-18 04:54:10 03142_untuple_crash: [ OK ] 0.68 sec.
2026-02-18 04:54:11 00098_k_union_all: [ OK ] 0.78 sec.
2026-02-18 04:54:12 01249_flush_interactive: [ OK ] 11.23 sec.
2026-02-18 04:54:13 02353_ascii: [ OK ] 0.58 sec.
2026-02-18 04:54:14 02733_sparse_columns_reload: [ OK ] 0.78 sec.
2026-02-18 04:54:15 02342_window_view_different_struct: [ OK ] 1.09 sec.
2026-02-18 04:54:16 02047_log_family_data_file_sizes: [ OK ] 14.69 sec.
2026-02-18 04:54:18 02718_parquet_metadata_format: [ OK ] 3.08 sec.
2026-02-18 04:54:18 01034_JSONCompactEachRow: [ OK ] 1.68 sec.
2026-02-18 04:54:19 00585_union_all_subquery_aggregation_column_removal: [ OK ] 1.23 sec.
2026-02-18 04:54:20 00964_bloom_index_string_functions: [ OK ] 22.53 sec.
2026-02-18 04:54:20 01559_aggregate_null_for_empty_fix: [ OK ] 0.80 sec.
2026-02-18 04:54:20 03120_analyzer_param_in_CTE_alias: [ OK ] 0.74 sec.
2026-02-18 04:54:21 01554_interpreter_integer_float: [ OK ] 0.78 sec.
2026-02-18 04:54:22 00916_add_materialized_column_after: [ OK ] 0.78 sec.
2026-02-18 04:54:22 02311_create_table_with_unknown_format: [ OK ] 0.78 sec.
2026-02-18 04:54:23 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 35.73 sec.
2026-02-18 04:54:23 01156_pcg_deserialization: [ OK ] 23.87 sec.
2026-02-18 04:54:23 02737_arrayJaccardIndex: [ OK ] 1.03 sec.
2026-02-18 04:54:24 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 1.03 sec.
2026-02-18 04:54:24 02735_array_map_array_of_tuples: [ OK ] 0.68 sec.
2026-02-18 04:54:24 01225_drop_dictionary_as_table: [ OK ] 0.78 sec.
2026-02-18 04:54:25 00738_nested_merge_multidimensional_array: [ OK ] 0.78 sec.
2026-02-18 04:54:25 01660_second_extremes_bug: [ OK ] 0.88 sec.
2026-02-18 04:54:26 02998_to_milliseconds: [ OK ] 1.08 sec.
2026-02-18 04:54:28 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 2.08 sec.
2026-02-18 04:54:28 02684_bson: [ OK ] 0.58 sec.
2026-02-18 04:54:29 01428_hash_set_nan_key: [ OK ] 0.73 sec.
2026-02-18 04:54:30 00734_timeslot: [ OK ] 0.98 sec.
2026-02-18 04:54:31 02294_decimal_second_errors: [ OK ] 0.63 sec.
2026-02-18 04:54:31 00411_long_accurate_number_comparison_int1: [ OK ] 31.94 sec.
2026-02-18 04:54:32 02254_projection_broken_part: [ OK ] 10.97 sec.
2026-02-18 04:54:32 02734_sparse_columns_short_circuit: [ OK ] 0.83 sec.
2026-02-18 04:54:32 01305_polygons_union: [ OK ] 1.13 sec.
2026-02-18 04:54:33 01651_lc_insert_tiny_log_1: [ OK ] 7.26 sec.
2026-02-18 04:54:33 01016_macros: [ OK ] 0.69 sec.
2026-02-18 04:54:33 01125_generate_random_qoega: [ OK ] 1.34 sec.
2026-02-18 04:54:33 02699_polygons_sym_difference_rollup: [ OK ] 0.78 sec.
2026-02-18 04:54:34 02128_cast_nullable: [ OK ] 0.83 sec.
2026-02-18 04:54:34 02125_dict_get_type_nullable_fix: [ OK ] 0.84 sec.
2026-02-18 04:54:34 01123_parse_date_time_best_effort_even_more: [ OK ] 0.68 sec.
2026-02-18 04:54:36 01720_join_implicit_cast: [ OK ] 2.94 sec.
2026-02-18 04:54:37 02955_analyzer_using_functional_args: [ OK ] 2.19 sec.
2026-02-18 04:54:37 02255_broken_parts_chain_on_start: [ OK ] 12.72 sec.
2026-02-18 04:54:37 02904_empty_order_by_with_setting_enabled: [ OK ] 3.19 sec.
2026-02-18 04:54:38 02841_not_ready_set_bug: [ OK ] 6.36 sec.
2026-02-18 04:54:38 03161_lightweight_delete_projection: [ OK ] 1.13 sec.
2026-02-18 04:54:38 03166_optimize_row_order_during_insert: [ OK ] 0.98 sec.
2026-02-18 04:54:39 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.73 sec.
2026-02-18 04:54:39 02417_null_variadic_behaviour: [ OK ] 1.37 sec.
2026-02-18 04:54:40 02158_proportions_ztest_cmp: [ OK ] 3.24 sec.
2026-02-18 04:54:40 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.63 sec.
2026-02-18 04:54:40 03003_prql_panic: [ OK ] 1.94 sec.
2026-02-18 04:54:40 01889_clickhouse_client_config_format: [ OK ] 3.69 sec.
2026-02-18 04:54:40 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.74 sec.
2026-02-18 04:54:41 03008_index_small: [ OK ] 0.79 sec.
2026-02-18 04:54:41 02992_analyzer_group_by_const: [ OK ] 1.43 sec.
2026-02-18 04:54:41 01778_where_with_column_name: [ OK ] 0.85 sec.
2026-02-18 04:54:42 02205_postgresql_functions: [ OK ] 1.33 sec.
2026-02-18 04:54:42 02883_read_in_reverse_order_virtual_column: [ OK ] 1.28 sec.
2026-02-18 04:54:42 00942_dataparts_500: [ OK ] 1.23 sec.
2026-02-18 04:54:42 02834_timestamp_function: [ OK ] 0.93 sec.
2026-02-18 04:54:43 02311_normalize_utf8_constant: [ OK ] 0.68 sec.
2026-02-18 04:54:43 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.98 sec.
2026-02-18 04:54:43 02918_analyzer_to_ast_crash: [ OK ] 0.78 sec.
2026-02-18 04:54:43 01383_log_broken_table: [ OK ] 60.15 sec.
2026-02-18 04:54:44 02513_broken_datetime64_init_on_mac: [ OK ] 0.83 sec.
2026-02-18 04:54:44 03158_dynamic_type_from_variant: [ OK ] 0.94 sec.
2026-02-18 04:54:44 00726_length_aliases: [ OK ] 0.63 sec.
2026-02-18 04:54:45 02246_clickhouse_local_drop_database: [ OK ] 2.28 sec.
2026-02-18 04:54:45 01352_generate_random_overflow: [ OK ] 0.83 sec.
2026-02-18 04:54:45 02177_issue_31009: [ SKIPPED ] 0.00 sec.
2026-02-18 04:54:45 Reason: not running for current build
2026-02-18 04:54:45 00875_join_right_nulls_ors: [ OK ] 1.04 sec.
2026-02-18 04:54:45 01333_select_abc_asterisk: [ OK ] 0.72 sec.
2026-02-18 04:54:46 02377_modify_column_from_lc: [ OK ] 1.18 sec.
2026-02-18 04:54:46 02720_row_policy_column_with_dots: [ OK ] 0.77 sec.
2026-02-18 04:54:46 02582_async_reading_with_small_limit: [ OK ] 0.88 sec.
2026-02-18 04:54:46 01183_custom_separated_format_http: [ OK ] 6.70 sec.
2026-02-18 04:54:46 02136_scalar_read_rows_json: [ OK ] 2.50 sec.
2026-02-18 04:54:47 02522_different_types_in_storage_merge: [ OK ] 0.68 sec.
2026-02-18 04:54:47 01474_custom_null_tsv: [ OK ] 4.29 sec.
2026-02-18 04:54:47 00700_decimal_with_default_precision_and_scale: [ OK ] 0.77 sec.
2026-02-18 04:54:47 01259_combinator_distinct: [ OK ] 0.88 sec.
2026-02-18 04:54:47 02985_minmax_index_aggregate_function: [ OK ] 1.13 sec.
2026-02-18 04:54:48 00339_parsing_bad_arrays: [ OK ] 1.33 sec.
2026-02-18 04:54:48 00600_create_temporary_table_if_not_exists: [ OK ] 0.78 sec.
2026-02-18 04:54:48 01535_decimal_round_scale_overflow_check: [ OK ] 0.88 sec.
2026-02-18 04:54:48 03073_analyzer_alias_as_column_name: [ OK ] 0.83 sec.
2026-02-18 04:54:48 00503_cast_const_nullable: [ OK ] 0.79 sec.
2026-02-18 04:54:49 03161_ipv4_ipv6_equality: [ OK ] 0.78 sec.
2026-02-18 04:54:49 02571_local_desc_abort_on_twitter_json: [ OK ] 1.68 sec.
2026-02-18 04:54:49 02515_analyzer_null_for_empty: [ OK ] 0.63 sec.
2026-02-18 04:54:50 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.67 sec.
2026-02-18 04:54:50 03210_nested_short_circuit_functions_bug: [ OK ] 0.72 sec.
2026-02-18 04:54:50 02030_client_unknown_database: [ OK ] 1.88 sec.
2026-02-18 04:54:50 02455_extract_fixed_string_from_nested_json: [ OK ] 0.68 sec.
2026-02-18 04:54:51 02910_replicated_merge_parameters_must_consistent: [ OK ] 1.38 sec.
2026-02-18 04:54:51 02324_map_combinator_bug: [ OK ] 0.98 sec.
2026-02-18 04:54:51 01607_arrays_as_nested_csv: [ OK ] 4.39 sec.
2026-02-18 04:54:51 02317_distinct_in_order_optimization: [ OK ] 3.09 sec.
2026-02-18 04:54:51 03010_read_system_parts_table_test: [ OK ] 0.77 sec.
2026-02-18 04:54:51 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.68 sec.
2026-02-18 04:54:52 01072_drop_temporary_table_with_same_name: [ OK ] 0.78 sec.
2026-02-18 04:54:52 02340_union_header: [ OK ] 0.58 sec.
2026-02-18 04:54:52 01069_database_memory: [ OK ] 0.84 sec.
2026-02-18 04:54:52 01470_columns_transformers2: [ OK ] 0.78 sec.
2026-02-18 04:54:53 00661_array_has_silviucpp: [ OK ] 0.68 sec.
2026-02-18 04:54:53 03165_string_functions_with_token_text_indexes: [ OK ] 1.94 sec.
2026-02-18 04:54:53 01032_cityHash64_for_decimal: [ OK ] 0.73 sec.
2026-02-18 04:54:53 01062_pm_multiple_all_join_same_value: [ OK ] 0.78 sec.
2026-02-18 04:54:53 02457_parse_date_time_best_effort: [ OK ] 1.07 sec.
2026-02-18 04:54:53 01255_geo_types_livace: [ OK ] 0.76 sec.
2026-02-18 04:54:54 02981_vertical_merges_memory_usage: [ OK ] 3.69 sec.
2026-02-18 04:54:54 00950_test_gorilla_codec: [ OK ] 0.99 sec.
2026-02-18 04:54:54 02518_delete_on_materialized_view: [ OK ] 0.72 sec.
2026-02-18 04:54:55 00819_ast_refactoring_bugs: [ OK ] 0.83 sec.
2026-02-18 04:54:55 02933_ephemeral_mv: [ OK ] 0.78 sec.
2026-02-18 04:54:55 02293_http_header_full_summary_without_progress: [ OK ] 2.24 sec.
2026-02-18 04:54:55 02981_translate_fixedstring: [ OK ] 0.93 sec.
2026-02-18 04:54:56 01090_fixed_string_bit_ops: [ OK ] 0.88 sec.
2026-02-18 04:54:56 00739_array_element_nullable_string_mattrobenolt: [ OK ] 1.03 sec.
2026-02-18 04:54:56 03143_group_by_constant_secondary: [ OK ] 0.74 sec.
2026-02-18 04:54:56 02185_arraySlice_negative_offset_size: [ OK ] 0.83 sec.
2026-02-18 04:54:57 01293_pretty_max_value_width: [ OK ] 1.19 sec.
2026-02-18 04:54:57 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.74 sec.
2026-02-18 04:54:58 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 2.95 sec.
2026-02-18 04:54:58 02560_vertical_merge_memory_usage: [ OK ] 5.47 sec.
2026-02-18 04:54:58 00625_arrays_in_nested: [ OK ] 1.08 sec.
2026-02-18 04:54:59 02176_optimize_aggregation_in_order_empty: [ OK ] 0.78 sec.
2026-02-18 04:54:59 00173_compare_date_time_with_constant_string: [ OK ] 1.33 sec.
2026-02-18 04:54:59 01681_hyperscan_debug_assertion: [ SKIPPED ] 0.00 sec.
2026-02-18 04:54:59 Reason: not running for current build
2026-02-18 04:55:00 00393_if_with_constant_condition: [ OK ] 0.78 sec.
2026-02-18 04:55:01 02874_analysis_of_variance_overflow: [ OK ] 0.78 sec.
2026-02-18 04:55:02 02813_any_value: [ OK ] 0.94 sec.
2026-02-18 04:55:03 01663_quantile_weighted_overflow: [ OK ] 0.78 sec.
2026-02-18 04:55:04 00639_startsWith: [ OK ] 0.83 sec.
2026-02-18 04:55:04 03198_orc_read_time_zone: [ OK ] 4.59 sec.
2026-02-18 04:55:04 01753_mutate_table_predicated_with_table: [ OK ] 0.88 sec.
2026-02-18 04:55:05 00952_part_frozen_info: [ OK ] 0.88 sec.
2026-02-18 04:55:05 01720_country_perimeter_and_area: [ OK ] 11.93 sec.
2026-02-18 04:55:05 02514_bad_index_granularity: [ OK ] 0.63 sec.
2026-02-18 04:55:05 01732_union_and_union_all: [ OK ] 0.68 sec.
2026-02-18 04:55:05 00556_array_intersect: [ OK ] 0.93 sec.
2026-02-18 04:55:06 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 8.80 sec.
2026-02-18 04:55:06 02680_datetime64_monotonic_check: [ OK ] 0.93 sec.
2026-02-18 04:55:06 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.93 sec.
2026-02-18 04:55:08 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 49.61 sec.
2026-02-18 04:55:08 02382_join_and_filtering_set: [ OK ] 1.03 sec.
2026-02-18 04:55:08 02910_object-json-crash-add-column: [ OK ] 1.23 sec.
2026-02-18 04:55:08 03205_system_sync_replica_format: [ OK ] 0.68 sec.
2026-02-18 04:55:08 02122_parallel_formatting_Pretty: [ OK ] 10.07 sec.
2026-02-18 04:55:09 02020_cast_integer_overflow: [ OK ] 0.68 sec.
2026-02-18 04:55:10 01339_client_unrecognized_option: [ OK ] 1.90 sec.
2026-02-18 04:55:10 03155_test_move_to_prewhere: [ OK ] 3.94 sec.
2026-02-18 04:55:10 01646_rewrite_sum_if: [ OK ] 1.68 sec.
2026-02-18 04:55:11 03006_join_on_inequal_expression_3: [ OK ] 1.58 sec.
2026-02-18 04:55:11 02352_grouby_shadows_arg: [ OK ] 0.73 sec.
2026-02-18 04:55:11 02988_ordinary_database_warning: [ OK ] 0.73 sec.
2026-02-18 04:55:12 01083_window_view_select: [ OK ] 6.20 sec.
2026-02-18 04:55:12 01280_null_in: [ OK ] 0.88 sec.
2026-02-18 04:55:13 02785_left_anti_join_bug: [ OK ] 0.90 sec.
2026-02-18 04:55:13 02992_all_columns_should_have_comment: [ OK ] 1.88 sec.
2026-02-18 04:55:13 00688_low_cardinality_dictionary_deserialization: [ OK ] 2.58 sec.
2026-02-18 04:55:14 02203_shebang: [ OK ] 1.53 sec.
2026-02-18 04:55:14 02250_ON_CLUSTER_grant: [ OK ] 4.60 sec.
2026-02-18 04:55:14 02769_compare_functions_nan: [ OK ] 1.13 sec.
2026-02-18 04:55:15 00836_indices_alter_replicated_zookeeper_long: [ OK ] 2.14 sec.
2026-02-18 04:55:15 01915_json_extract_raw_string: [ OK ] 0.89 sec.
2026-02-18 04:55:15 03156_nullable_number_tips: [ OK ] 1.03 sec.
2026-02-18 04:55:16 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 4.45 sec.
2026-02-18 04:55:16 02131_row_policies_combination: [ OK ] 1.22 sec.
2026-02-18 04:55:17 01474_decimal_scale_bug: [ OK ] 0.93 sec.
2026-02-18 04:55:18 02489_analyzer_indexes: [ OK ] 1.28 sec.
2026-02-18 04:55:18 02910_nullable_enum_cast: [ OK ] 0.83 sec.
2026-02-18 04:55:19 02995_preliminary_filters_duplicated_columns: [ OK ] 0.78 sec.
2026-02-18 04:55:19 02346_fulltext_index_search: [ OK ] 5.00 sec.
2026-02-18 04:55:19 02004_intersect_except_distinct_operators: [ OK ] 1.79 sec.
2026-02-18 04:55:20 02714_async_inserts_empty_data: [ OK ] 5.02 sec.
2026-02-18 04:55:21 02456_aggregate_state_conversion: [ OK ] 0.68 sec.
2026-02-18 04:55:22 02790_url_multiple_tsv_files: [ OK ] 2.55 sec.
2026-02-18 04:55:22 02100_now64_types_bug: [ OK ] 0.63 sec.
2026-02-18 04:55:22 01351_geohash_assert: [ OK ] 0.53 sec.
2026-02-18 04:55:23 01388_multi_if_optimization: [ OK ] 0.68 sec.
2026-02-18 04:55:24 02864_restore_table_with_broken_part: [ OK ] 4.94 sec.
2026-02-18 04:55:24 02131_used_row_policies_in_query_log: [ OK ] 1.48 sec.
2026-02-18 04:55:25 00590_limit_by_column_removal: [ OK ] 0.83 sec.
2026-02-18 04:55:25 01945_show_debug_warning: [ OK ] 5.22 sec.
2026-02-18 04:55:25 00029_test_zookeeper_optimize_exception: [ OK ] 10.21 sec.
2026-02-18 04:55:26 02962_join_using_bug_57894: [ OK ] 0.89 sec.
2026-02-18 04:55:26 01457_int256_hashing: [ OK ] 0.89 sec.
2026-02-18 04:55:26 00098_7_union_all: [ OK ] 0.69 sec.
2026-02-18 04:55:27 00740_database_in_nested_view: [ OK ] 1.03 sec.
2026-02-18 04:55:27 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.93 sec.
2026-02-18 04:55:27 02033_join_engine_deadlock_long: [ OK ] 4.29 sec.
2026-02-18 04:55:27 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 19.51 sec.
2026-02-18 04:55:27 02952_clickhouse_local_query_parameters_cli: [ OK ] 1.44 sec.
2026-02-18 04:55:28 00904_array_with_constant_2: [ OK ] 0.78 sec.
2026-02-18 04:55:28 00593_union_all_assert_columns_removed: [ OK ] 0.78 sec.
2026-02-18 04:55:28 00447_foreach_modifier: [ OK ] 0.88 sec.
2026-02-18 04:55:28 00570_empty_array_is_const: [ OK ] 0.68 sec.
2026-02-18 04:55:29 00534_exp10: [ OK ] 0.63 sec.
2026-02-18 04:55:29 02336_sort_optimization_with_fill: [ OK ] 0.73 sec.
2026-02-18 04:55:29 02456_alter-nullable-column-bag: [ OK ] 0.78 sec.
2026-02-18 04:55:29 00617_array_in: [ OK ] 0.83 sec.
2026-02-18 04:55:29 01700_point_in_polygon_ubsan: [ OK ] 0.74 sec.
2026-02-18 04:55:30 02344_describe_cache: [ OK ] 3.14 sec.
2026-02-18 04:55:30 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.73 sec.
2026-02-18 04:55:30 01825_type_json_ghdata_insert_select: [ OK ] 34.20 sec.
2026-02-18 04:55:30 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.83 sec.
2026-02-18 04:55:31 02959_system_database_engines: [ OK ] 0.63 sec.
2026-02-18 04:55:31 01684_insert_specify_shard_id: [ OK ] 1.13 sec.
2026-02-18 04:55:32 01496_signedness_conversion_monotonicity: [ OK ] 0.63 sec.
2026-02-18 04:55:32 01576_if_null_external_aggregation: [ OK ] 2.88 sec.
2026-02-18 04:55:32 03023_invalid_format_detection: [ OK ] 1.79 sec.
2026-02-18 04:55:32 03143_parallel_replicas_mat_view_bug: [ OK ] 0.84 sec.
2026-02-18 04:55:33 00627_recursive_alias: [ OK ] 0.68 sec.
2026-02-18 04:55:33 01098_sum: [ OK ] 0.78 sec.
2026-02-18 04:55:33 02110_clickhouse_local_custom_tld: [ OK ] 1.48 sec.
2026-02-18 04:55:33 02790_fix_coredump_when_compile_expression: [ OK ] 0.63 sec.
2026-02-18 04:55:34 03443_projection_sparse: [ OK ] 0.83 sec.
2026-02-18 04:55:34 00632_aggregation_window_funnel: [ OK ] 2.19 sec.
2026-02-18 04:55:35 02027_ngrams: [ OK ] 0.98 sec.
2026-02-18 04:55:35 02271_temporary_table_show_rows_bytes: [ OK ] 0.73 sec.
2026-02-18 04:55:35 01032_duplicate_column_insert_query: [ OK ] 0.73 sec.
2026-02-18 04:55:35 01019_array_fill: [ OK ] 0.68 sec.
2026-02-18 04:55:37 02721_url_cluster: [ OK ] 1.43 sec.
2026-02-18 04:55:38 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.83 sec.
2026-02-18 04:55:38 01244_optimize_distributed_group_by_sharding_key: [ OK ] 2.49 sec.
2026-02-18 04:55:39 02461_welch_t_test_fuzz: [ OK ] 0.73 sec.
2026-02-18 04:55:40 00650_csv_with_specified_quote_rule: [ OK ] 12.02 sec.
2026-02-18 04:55:40 01947_mv_subquery: [ OK ] 2.28 sec.
2026-02-18 04:55:40 03313_case_insensitive_json_type_declaration: [ OK ] 0.58 sec.
2026-02-18 04:55:40 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 1.53 sec.
2026-02-18 04:55:41 02128_apply_lambda_parsing: [ OK ] 0.68 sec.
2026-02-18 04:55:41 01051_same_name_alias_with_joins: [ OK ] 0.83 sec.
2026-02-18 04:55:41 02097_remove_sample_by: [ OK ] 0.92 sec.
2026-02-18 04:55:42 01424_parse_date_time_bad_date: [ OK ] 0.83 sec.
2026-02-18 04:55:42 00743_limit_by_not_found_column: [ OK ] 0.78 sec.
2026-02-18 04:55:42 01710_projection_optimize_materialize: [ OK ] 1.38 sec.
2026-02-18 04:55:43 01710_projection_detach_part: [ OK ] 0.78 sec.
2026-02-18 04:55:43 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 9.51 sec.
2026-02-18 04:55:43 01268_mv_scalars: [ OK ] 1.23 sec.
2026-02-18 04:55:44 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 1.53 sec.
2026-02-18 04:55:44 02960_alter_table_part_query_parameter: [ OK ] 0.82 sec.
2026-02-18 04:55:44 02508_index_analysis_to_date_timezone: [ OK ] 0.88 sec.
2026-02-18 04:55:44 00497_whitespaces_in_insert: [ OK ] 10.43 sec.
2026-02-18 04:55:45 02381_join_dup_columns_in_plan: [ OK ] 1.18 sec.
2026-02-18 04:55:46 02423_ddl_for_opentelemetry: [ OK ] 21.82 sec.
2026-02-18 04:55:46 01871_merge_tree_compile_expressions: [ OK ] 1.88 sec.
2026-02-18 04:55:46 03215_view_with_recursive: [ OK ] 1.18 sec.
2026-02-18 04:55:47 02864_profile_event_part_lock: [ OK ] 0.89 sec.
2026-02-18 04:55:47 03049_unknown_identifier_materialized_column: [ OK ] 0.78 sec.
2026-02-18 04:55:47 00277_array_filter: [ OK ] 0.83 sec.
2026-02-18 04:55:47 02697_stop_reading_on_first_cancel: [ OK ] 3.39 sec.
2026-02-18 04:55:47 02207_ttl_move_if_exists: [ OK ] 0.53 sec.
2026-02-18 04:55:47 00276_sample: [ OK ] 3.79 sec.
2026-02-18 04:55:47 00085_visible_width_of_tuple_of_dates: [ OK ] 0.63 sec.
2026-02-18 04:55:48 01389_filter_by_virtual_columns: [ OK ] 0.68 sec.
2026-02-18 04:55:48 02561_sorting_constants_and_distinct_crash: [ OK ] 3.90 sec.
2026-02-18 04:55:48 03039_unknown_identifier_window_function: [ OK ] 0.78 sec.
2026-02-18 04:55:49 00980_merge_alter_settings: [ OK ] 1.38 sec.
2026-02-18 04:55:49 01616_untuple_access_field: [ OK ] 0.73 sec.
2026-02-18 04:55:49 01051_window_view_parser_hop: [ OK ] 1.13 sec.
2026-02-18 04:55:49 00688_low_cardinality_alter_add_column: [ OK ] 0.68 sec.
2026-02-18 04:55:49 00300_csv: [ OK ] 0.63 sec.
2026-02-18 04:55:49 02387_parse_date_as_datetime: [ OK ] 0.67 sec.
2026-02-18 04:55:49 02115_write_buffers_finalize: [ OK ] 19.05 sec.
2026-02-18 04:55:49 00680_duplicate_columns_inside_union_all: [ OK ] 0.80 sec.
2026-02-18 04:55:50 03037_union_view: [ OK ] 0.82 sec.
2026-02-18 04:55:50 03142_alter_comment_parameterized_view: [ OK ] 0.68 sec.
2026-02-18 04:55:50 01074_h3_range_check: [ OK ] 0.78 sec.
2026-02-18 04:55:50 02751_multiif_to_if_crash: [ OK ] 0.98 sec.
2026-02-18 04:55:51 02896_leading_zeroes_no_octal: [ OK ] 3.39 sec.
2026-02-18 04:55:51 01267_alter_default_key_columns_zookeeper_long: [ OK ] 1.23 sec.
2026-02-18 04:55:51 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.89 sec.
2026-02-18 04:55:51 02481_pk_analysis_with_enum_to_string: [ OK ] 1.03 sec.
2026-02-18 04:55:52 00252_shard_global_in_aggregate_function: [ OK ] 0.94 sec.
2026-02-18 04:55:52 02897_alter_partition_parameters: [ OK ] 1.58 sec.
2026-02-18 04:55:52 00104_totals_having_mode: [ OK ] 1.04 sec.
2026-02-18 04:55:53 01104_distributed_one_test: [ OK ] 1.03 sec.
2026-02-18 04:55:54 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 6.55 sec.
2026-02-18 04:55:54 00621_regression_for_in_operator: [ OK ] 1.03 sec.
2026-02-18 04:55:54 01477_lc_in_merge_join_left_key: [ OK ] 1.95 sec.
2026-02-18 04:55:55 02376_analyzer_in_function_subquery: [ OK ] 1.03 sec.
2026-02-18 04:55:55 00523_aggregate_functions_in_group_array: [ OK ] 0.68 sec.
2026-02-18 04:55:55 03129_cte_with_final: [ OK ] 0.88 sec.
2026-02-18 04:55:56 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.78 sec.
2026-02-18 04:55:56 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.83 sec.
2026-02-18 04:55:56 00473_output_format_json_quote_denormals: [ OK ] 5.29 sec.
2026-02-18 04:55:56 02771_skip_empty_files: [ OK ] 5.21 sec.
2026-02-18 04:55:56 00574_empty_strings_deserialization: [ OK ] 5.90 sec.
2026-02-18 04:55:56 01700_system_zookeeper_path_in: [ OK ] 0.93 sec.
2026-02-18 04:55:56 02680_default_star: [ OK ] 0.58 sec.
2026-02-18 04:55:57 02267_type_inference_for_insert_into_function_null: [ OK ] 0.68 sec.
2026-02-18 04:55:57 00563_shard_insert_into_remote: [ OK ] 0.90 sec.
2026-02-18 04:55:57 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.83 sec.
2026-02-18 04:55:57 03095_msan_uuid_string_to_num: [ OK ] 0.78 sec.
2026-02-18 04:55:58 03048_not_found_column_xxx_in_block: [ OK ] 0.93 sec.
2026-02-18 04:55:58 00180_attach_materialized_view: [ OK ] 0.83 sec.
2026-02-18 04:55:58 00292_parser_tuple_element: [ OK ] 0.63 sec.
2026-02-18 04:55:59 02843_context_has_expired: [ OK ] 0.88 sec.
2026-02-18 04:55:59 01849_geoToS2: [ OK ] 1.28 sec.
2026-02-18 04:56:00 00700_decimal_aggregates: [ OK ] 2.94 sec.
2026-02-18 04:56:00 02493_analyzer_table_functions_untuple: [ OK ] 0.89 sec.
2026-02-18 04:56:00 00321_pk_set: [ OK ] 0.83 sec.
2026-02-18 04:56:00 02921_fuzzbits_with_array_join: [ OK ] 0.73 sec.
2026-02-18 04:56:01 02947_dropped_tables_parts: [ OK ] 0.93 sec.
2026-02-18 04:56:01 02151_client_option_echo: [ OK ] 3.64 sec.
2026-02-18 04:56:01 03209_parameterized_view_with_non_literal_params: [ OK ] 1.83 sec.
2026-02-18 04:56:02 02421_type_json_async_insert: [ OK ] 6.50 sec.
2026-02-18 04:56:02 02178_column_function_insert_from: [ OK ] 0.78 sec.
2026-02-18 04:56:03 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 1.28 sec.
2026-02-18 04:56:03 03008_filter_projections_non_deterministoc_functions: [ OK ] 1.33 sec.
2026-02-18 04:56:03 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.72 sec.
2026-02-18 04:56:03 00360_to_date_from_string_with_datetime: [ OK ] 0.67 sec.
2026-02-18 04:56:04 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.83 sec.
2026-02-18 04:56:04 02409_url_format_detection: [ OK ] 0.73 sec.
2026-02-18 04:56:04 00826_cross_to_inner_join: [ OK ] 1.63 sec.
2026-02-18 04:56:04 02125_lz4_compression_bug_CSV: [ OK ] 11.99 sec.
2026-02-18 04:56:04 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.83 sec.
2026-02-18 04:56:04 02918_multif_for_nullable: [ OK ] 4.24 sec.
2026-02-18 04:56:05 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.68 sec.
2026-02-18 04:56:05 00862_decimal_in: [ OK ] 1.03 sec.
2026-02-18 04:56:05 01170_alter_partition_isolation: [ OK ] 9.31 sec.
2026-02-18 04:56:05 01020_having_without_group_by: [ OK ] 0.78 sec.
2026-02-18 04:56:05 00278_insert_already_sorted: [ OK ] 1.28 sec.
2026-02-18 04:56:06 02458_datediff_date32: [ OK ] 1.33 sec.
2026-02-18 04:56:06 01431_utf8_ubsan: [ OK ] 0.63 sec.
2026-02-18 04:56:07 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.68 sec.
2026-02-18 04:56:09 02786_parquet_big_integer_compatibility: [ OK ] 1.83 sec.
2026-02-18 04:56:09 02122_parallel_formatting_JSONCompact: [ OK ] 4.79 sec.
2026-02-18 04:56:09 01417_update_permutation_crash: [ OK ] 0.78 sec.
2026-02-18 04:56:10 02475_join_bug_42832: [ OK ] 0.87 sec.
2026-02-18 04:56:10 02845_parquet_odd_decimals: [ OK ] 3.74 sec.
2026-02-18 04:56:10 00365_statistics_in_formats: [ OK ] 5.95 sec.
2026-02-18 04:56:12 03167_base64_url_functions_sh: [ OK ] 121.10 sec.
2026-02-18 04:56:13 02096_bad_options_in_client_and_local: [ OK ] 3.18 sec.
2026-02-18 04:56:13 02151_http_s_structure_set_eof: [ OK ] 3.29 sec.
2026-02-18 04:56:13 03006_buffer_overflow_join: [ OK ] 0.63 sec.
2026-02-18 04:56:13 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 9.01 sec.
2026-02-18 04:56:13 02920_rename_column_of_skip_indices: [ OK ] 0.78 sec.
2026-02-18 04:56:14 01798_having_push_down: [ OK ] 0.83 sec.
2026-02-18 04:56:14 00379_system_processes_port: [ OK ] 1.18 sec.
2026-02-18 04:56:14 02932_query_settings_max_size_drop: [ OK ] 1.03 sec.
2026-02-18 04:56:15 02481_i43247_ubsan_in_minmaxany: [ OK ] 4.04 sec.
2026-02-18 04:56:15 00053_all_inner_join: [ OK ] 0.68 sec.
2026-02-18 04:56:16 02813_seriesDecomposeSTL: [ OK ] 1.03 sec.
2026-02-18 04:56:16 03169_modify_column_data_loss: [ OK ] 0.88 sec.
2026-02-18 04:56:16 02874_array_random_sample: [ OK ] 11.01 sec.
2026-02-18 04:56:17 03036_dynamic_read_subcolumns_memory: [ OK ] 2.89 sec.
2026-02-18 04:56:17 03215_parquet_index: [ OK ] 0.98 sec.
2026-02-18 04:56:18 02126_fix_filelog: [ OK ] 4.85 sec.
2026-02-18 04:56:18 02471_wrong_date_monotonicity: [ OK ] 0.78 sec.
2026-02-18 04:56:18 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 12.72 sec.
2026-02-18 04:56:19 00555_right_join_excessive_rows: [ OK ] 0.78 sec.
2026-02-18 04:56:19 02535_json_bson_each_row_curl: [ OK ] 4.40 sec.
2026-02-18 04:56:19 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.68 sec.
2026-02-18 04:56:19 00125_array_element_of_array_of_tuple: [ OK ] 0.73 sec.
2026-02-18 04:56:20 01710_normal_projection_join_plan_fix: [ OK ] 0.73 sec.
2026-02-18 04:56:20 02560_window_ntile: [ OK ] 1.23 sec.
2026-02-18 04:56:20 01385_not_function: [ OK ] 0.78 sec.
2026-02-18 04:56:20 02242_case_insensitive_column_matching: [ OK ] 10.46 sec.
2026-02-18 04:56:20 01067_join_null: [ OK ] 0.73 sec.
2026-02-18 04:56:21 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 4.49 sec.
2026-02-18 04:56:21 03001_data_version_column: [ OK ] 0.78 sec.
2026-02-18 04:56:21 02158_proportions_ztest: [ OK ] 0.78 sec.
2026-02-18 04:56:21 02381_parseDateTime64BestEffortUS: [ OK ] 0.73 sec.
2026-02-18 04:56:22 03031_filter_float64_logical_error: [ OK ] 0.73 sec.
2026-02-18 04:56:23 02160_client_autocomplete_parse_query: [ OK ] 2.83 sec.
2026-02-18 04:56:23 00372_cors_header: [ OK ] 1.23 sec.
2026-02-18 04:56:24 01513_optimize_aggregation_in_order_memory_long: [ OK ] 8.16 sec.
2026-02-18 04:56:24 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.78 sec.
2026-02-18 04:56:24 01274_alter_rename_column_distributed: [ OK ] 0.98 sec.
2026-02-18 04:56:25 01553_datetime64_comparison: [ OK ] 0.73 sec.
2026-02-18 04:56:25 01083_match_zero_byte: [ OK ] 0.82 sec.
2026-02-18 04:56:25 00534_functions_bad_arguments4_long: [ SKIPPED ] 0.00 sec.
2026-02-18 04:56:25 Reason: not running for current build
2026-02-18 04:56:26 01914_index_bgranvea: [ OK ] 0.79 sec.
2026-02-18 04:56:26 02531_two_level_aggregation_bug: [ OK ] 2.74 sec.
2026-02-18 04:56:27 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 9.42 sec.
2026-02-18 04:56:27 02111_with_fill_no_rows: [ OK ] 0.73 sec.
2026-02-18 04:56:28 01950_kill_large_group_by_query: [ OK ] 3.23 sec.
2026-02-18 04:56:28 02986_leftpad_fixedstring: [ OK ] 0.77 sec.
2026-02-18 04:56:28 01302_polygons_distance: [ OK ] 0.83 sec.
2026-02-18 04:56:29 01710_projection_in_set: [ OK ] 0.82 sec.
2026-02-18 04:56:29 00566_enum_min_max: [ OK ] 0.73 sec.
2026-02-18 04:56:30 02971_analyzer_remote_id: [ OK ] 2.28 sec.
2026-02-18 04:56:30 01926_bin_unbin: [ OK ] 1.03 sec.
2026-02-18 04:56:30 01050_group_array_sample: [ OK ] 0.63 sec.
2026-02-18 04:56:30 02031_format_query_option: [ OK ] 1.23 sec.
2026-02-18 04:56:31 00698_validate_array_sizes_for_nested: [ OK ] 0.73 sec.
2026-02-18 04:56:32 02242_make_date_mysql: [ OK ] 1.03 sec.
2026-02-18 04:56:33 02221_system_zookeeper_unrestricted_like: [ OK ] 6.41 sec.
2026-02-18 04:56:34 01049_join_low_card_bug_long: [ OK ] 13.49 sec.
2026-02-18 04:56:35 02999_ulid_short_circuit: [ OK ] 0.73 sec.
2026-02-18 04:56:36 01825_new_type_json_18: [ OK ] 0.78 sec.
2026-02-18 04:56:37 00989_parallel_parts_loading: [ OK ] 5.00 sec.
2026-02-18 04:56:38 02132_client_history_navigation: [ OK ] 1.85 sec.
2026-02-18 04:56:38 02306_rowbinary_has_no_bom: [ OK ] 1.38 sec.
2026-02-18 04:56:39 01277_large_tuples: [ OK ] 0.69 sec.
2026-02-18 04:56:39 02963_single_value_destructor: [ OK ] 1.13 sec.
2026-02-18 04:56:39 02423_insert_stats_behaviour: [ OK ] 8.47 sec.
2026-02-18 04:56:40 01825_type_json_in_array: [ OK ] 1.08 sec.
2026-02-18 04:56:40 00916_join_using_duplicate_columns: [ OK ] 1.08 sec.
2026-02-18 04:56:41 02129_skip_quoted_fields: [ OK ] 19.86 sec.
2026-02-18 04:56:41 01561_aggregate_functions_of_key_with_join: [ OK ] 0.57 sec.
2026-02-18 04:56:42 01825_new_type_json_nbagames: [ OK ] 24.58 sec.
2026-02-18 04:56:42 03038_nested_dynamic_merges_compact_vertical: [ OK ] 9.41 sec.
2026-02-18 04:56:43 01655_test_isnull_mysql_dialect: [ OK ] 0.63 sec.
2026-02-18 04:56:43 03164_parallel_replicas_range_filter_min_max: [ OK ] 1.49 sec.
2026-02-18 04:56:44 01213_alter_rename_nested: [ OK ] 0.89 sec.
2026-02-18 04:56:44 03204_format_join_on: [ OK ] 1.43 sec.
2026-02-18 04:56:45 02661_read_from_archive_zip: [ OK ] 23.63 sec.
2026-02-18 04:56:46 00666_uniq_complex_types: [ OK ] 1.35 sec.
2026-02-18 04:56:46 01113_local_dictionary_type_conversion: [ OK ] 0.73 sec.
2026-02-18 04:56:46 01581_deduplicate_by_columns_local: [ OK ] 1.88 sec.
2026-02-18 04:56:47 00028_shard_big_agg_aj_distributed: [ OK ] 1.03 sec.
2026-02-18 04:56:47 01556_explain_select_with_union_query: [ OK ] 1.03 sec.
2026-02-18 04:56:48 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 6.18 sec.
2026-02-18 04:56:48 02131_materialize_column_cast: [ OK ] 0.88 sec.
2026-02-18 04:56:49 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.88 sec.
2026-02-18 04:56:50 02801_backup_native_copy: [ OK ] 10.37 sec.
2026-02-18 04:56:50 01498_alter_column_storage_memory: [ OK ] 0.68 sec.
2026-02-18 04:56:51 01403_datetime64_constant_arg: [ OK ] 0.68 sec.
2026-02-18 04:56:51 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 3.75 sec.
2026-02-18 04:56:51 02293_ttest_large_samples: [ OK ] 3.71 sec.
2026-02-18 04:56:52 03038_nested_dynamic_merges_wide_vertical: [ OK ] 6.40 sec.
2026-02-18 04:56:52 02361_fsync_profile_events: [ OK ] 3.44 sec.
2026-02-18 04:56:52 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 1.23 sec.
2026-02-18 04:56:53 02869_http_headers_elapsed_ns: [ OK ] 1.33 sec.
2026-02-18 04:56:53 00487_if_array_fixed_string: [ OK ] 0.63 sec.
2026-02-18 04:56:53 02436_system_zookeeper_context: [ OK ] 0.73 sec.
2026-02-18 04:56:53 01780_column_sparse_tuple: [ OK ] 1.08 sec.
2026-02-18 04:56:54 01273_lc_fixed_string_field: [ OK ] 0.88 sec.
2026-02-18 04:56:54 02293_h3_hex_ring: [ OK ] 1.08 sec.
2026-02-18 04:56:54 01770_extended_range_3: [ OK ] 0.68 sec.
2026-02-18 04:56:54 01472_many_rows_in_totals: [ OK ] 0.78 sec.
2026-02-18 04:56:55 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.78 sec.
2026-02-18 04:56:55 03003_analyzer_setting: [ OK ] 0.78 sec.
2026-02-18 04:56:56 03160_dynamic_type_agg: [ OK ] 0.78 sec.
2026-02-18 04:56:56 01667_aes_args_check: [ OK ] 0.63 sec.
2026-02-18 04:56:57 01710_normal_projection_format: [ OK ] 0.63 sec.
2026-02-18 04:56:57 02418_keeper_map_keys_limit: [ OK ] 1.03 sec.
2026-02-18 04:56:57 02841_tuple_modulo: [ OK ] 0.63 sec.
2026-02-18 04:56:57 03100_analyzer_constants_in_multiif: [ OK ] 0.73 sec.
2026-02-18 04:56:58 02554_invalid_create_view_syntax: [ OK ] 0.62 sec.
2026-02-18 04:56:58 02678_explain_pipeline_graph_with_projection: [ OK ] 0.83 sec.
2026-02-18 04:56:59 02521_tsv_csv_custom_header_detection: [ OK ] 18.01 sec.
2026-02-18 04:56:59 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.73 sec.
2026-02-18 04:56:59 02835_fuzz_remove_redundant_sorting: [ OK ] 1.04 sec.
2026-02-18 04:57:00 02534_join_prewhere_bug: [ OK ] 0.98 sec.
2026-02-18 04:57:01 02456_async_inserts_logs: [ OK ] 7.96 sec.
2026-02-18 04:57:01 01748_partition_id_pruning: [ OK ] 0.93 sec.
2026-02-18 04:57:01 01099_operators_date_and_timestamp: [ OK ] 1.94 sec.
2026-02-18 04:57:02 00978_sum_map_bugfix: [ OK ] 0.88 sec.
2026-02-18 04:57:02 02842_vertical_merge_after_add_drop_column: [ OK ] 0.93 sec.
2026-02-18 04:57:02 01665_substring_ubsan: [ OK ] 0.83 sec.
2026-02-18 04:57:03 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.94 sec.
2026-02-18 04:57:03 00903_array_with_constant_function: [ OK ] 0.89 sec.
2026-02-18 04:57:03 00492_drop_temporary_table: [ OK ] 0.99 sec.
2026-02-18 04:57:03 01921_with_fill_with_totals: [ OK ] 0.73 sec.
2026-02-18 04:57:04 02967_fuzz_bad_cast: [ OK ] 0.78 sec.
2026-02-18 04:57:04 01053_drop_database_mat_view: [ OK ] 0.98 sec.
2026-02-18 04:57:04 03203_client_benchmark_options: [ OK ] 10.03 sec.
2026-02-18 04:57:05 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.83 sec.
2026-02-18 04:57:05 02317_distinct_in_order_optimization_explain: [ OK ] 34.43 sec.
2026-02-18 04:57:05 01398_in_tuple_func: [ OK ] 0.98 sec.
2026-02-18 04:57:05 01558_transform_null_in: [ OK ] 1.14 sec.
2026-02-18 04:57:06 01097_one_more_range_reader_test_wide_part: [ OK ] 0.98 sec.
2026-02-18 04:57:06 01901_in_literal_shard_prune: [ OK ] 0.93 sec.
2026-02-18 04:57:06 03004_force_null_for_omitted: [ OK ] 1.69 sec.
2026-02-18 04:57:07 01251_string_comparison: [ OK ] 0.90 sec.
2026-02-18 04:57:07 00471_sql_style_quoting: [ OK ] 0.78 sec.
2026-02-18 04:57:08 00324_hashing_enums: [ OK ] 0.88 sec.
2026-02-18 04:57:08 01780_column_sparse_full: [ OK ] 2.19 sec.
2026-02-18 04:57:08 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.99 sec.
2026-02-18 04:57:08 01018_ddl_dictionaries_select: [ OK ] 1.70 sec.
2026-02-18 04:57:08 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.73 sec.
2026-02-18 04:57:09 02833_std_alias: [ OK ] 0.67 sec.
2026-02-18 04:57:09 02008_materialize_column: [ OK ] 1.14 sec.
2026-02-18 04:57:09 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.78 sec.
2026-02-18 04:57:09 02533_generate_random_schema_inference: [ OK ] 0.88 sec.
2026-02-18 04:57:10 01072_json_each_row_data_in_square_brackets: [ OK ] 0.78 sec.
2026-02-18 04:57:10 02012_changed_enum_type_non_replicated: [ OK ] 0.94 sec.
2026-02-18 04:57:10 02375_pretty_formats: [ OK ] 0.98 sec.
2026-02-18 04:57:11 02400_memory_accounting_on_error: [ OK ] 1.39 sec.
2026-02-18 04:57:11 01954_clickhouse_benchmark_multiple_long: [ OK ] 20.23 sec.
2026-02-18 04:57:12 02180_group_by_lowcardinality: [ OK ] 0.38 sec.
2026-02-18 04:57:12 03200_subcolumns_join_use_nulls: [ OK ] 0.83 sec.
2026-02-18 04:57:12 02205_map_populate_series_non_const: [ OK ] 1.90 sec.
2026-02-18 04:57:12 01654_test_writer_block_sequence: [ OK ] 32.46 sec.
2026-02-18 04:57:13 03261_sort_cursor_crash: [ OK ] 0.93 sec.
2026-02-18 04:57:13 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.88 sec.
2026-02-18 04:57:13 01834_alias_columns_laziness_filimonov: [ OK ] 3.34 sec.
2026-02-18 04:57:13 00910_decimal_group_array_crash_3783: [ OK ] 0.88 sec.
2026-02-18 04:57:14 00009_array_join_subquery: [ OK ] 0.63 sec.
2026-02-18 04:57:14 01084_regexp_empty: [ OK ] 0.83 sec.
2026-02-18 04:57:14 01825_new_type_json_7: [ OK ] 5.41 sec.
2026-02-18 04:57:14 02374_analyzer_array_join: [ OK ] 1.08 sec.
2026-02-18 04:57:15 00854_multiple_join_asterisks: [ OK ] 0.78 sec.
2026-02-18 04:57:15 03034_normalized_ast: [ OK ] 0.78 sec.
2026-02-18 04:57:15 00318_pk_tuple_order: [ OK ] 1.53 sec.
2026-02-18 04:57:16 00810_in_operators_segfault: [ OK ] 0.68 sec.
2026-02-18 04:57:16 00686_client_exit_code: [ OK ] 1.79 sec.
2026-02-18 04:57:17 00804_rollup_with_having: [ OK ] 0.93 sec.
2026-02-18 04:57:17 01012_select_limit_x_0: [ OK ] 0.69 sec.
2026-02-18 04:57:17 01460_line_as_string_format: [ OK ] 18.57 sec.
2026-02-18 04:57:18 02465_limit_trivial_max_rows_to_read: [ OK ] 0.93 sec.
2026-02-18 04:57:18 00564_versioned_collapsing_merge_tree: [ OK ] 14.33 sec.
2026-02-18 04:57:18 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.67 sec.
2026-02-18 04:57:18 03151_external_cross_join: [ OK ] 2.79 sec.
2026-02-18 04:57:18 02457_filesystem_function: [ OK ] 0.83 sec.
2026-02-18 04:57:19 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.78 sec.
2026-02-18 04:57:19 00387_use_client_time_zone: [ OK ] 1.73 sec.
2026-02-18 04:57:19 01355_alter_column_with_order: [ OK ] 0.88 sec.
2026-02-18 04:57:19 01825_type_json_16: [ OK ] 5.71 sec.
2026-02-18 04:57:19 02263_format_insert_settings: [ OK ] 7.41 sec.
2026-02-18 04:57:19 00966_invalid_json_must_not_parse: [ OK ] 0.78 sec.
2026-02-18 04:57:20 02017_columns_with_dot_2: [ OK ] 0.93 sec.
2026-02-18 04:57:20 02967_index_hint_crash: [ OK ] 0.68 sec.
2026-02-18 04:57:20 02246_flatten_tuple: [ OK ] 0.98 sec.
2026-02-18 04:57:21 01269_create_with_null: [ OK ] 0.78 sec.
2026-02-18 04:57:21 00586_removing_unused_columns_from_subquery: [ OK ] 0.88 sec.
2026-02-18 04:57:21 02908_table_ttl_dependency: [ OK ] 3.13 sec.
2026-02-18 04:57:21 01047_no_alias_columns_with_table_aliases: [ OK ] 0.83 sec.
2026-02-18 04:57:21 02332_dist_insert_send_logs_level: [ OK ] 2.43 sec.
2026-02-18 04:57:22 00308_write_buffer_valid_utf8: [ OK ] 0.78 sec.
2026-02-18 04:57:22 00131_set_hashed: [ OK ] 0.88 sec.
2026-02-18 04:57:22 01868_order_by_fill_with_datetime64: [ OK ] 0.83 sec.
2026-02-18 04:57:22 00369_int_div_of_float: [ OK ] 0.68 sec.
2026-02-18 04:57:22 02490_replacing_merge_tree_is_deleted_column_transform_opt: [ OK ] 1.38 sec.
2026-02-18 04:57:23 00953_indices_alter_exceptions: [ OK ] 4.10 sec.
2026-02-18 04:57:23 03008_deduplication_insert_into_partitioned_table: [ OK ] 2.04 sec.
2026-02-18 04:57:23 02969_archive_seek: [ OK ] 1.49 sec.
2026-02-18 04:57:24 02189_join_type_conversion: [ OK ] 0.68 sec.
2026-02-18 04:57:24 00974_low_cardinality_cast: [ OK ] 0.79 sec.
2026-02-18 04:57:24 02731_parallel_replicas_join_subquery: [ OK ] 2.63 sec.
2026-02-18 04:57:24 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 1.79 sec.
2026-02-18 04:57:24 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.88 sec.
2026-02-18 04:57:25 02841_group_array_sorted: [ OK ] 1.58 sec.
2026-02-18 04:57:25 02380_analyzer_join_sample: [ OK ] 0.73 sec.
2026-02-18 04:57:25 01441_array_combinator: [ OK ] 0.78 sec.
2026-02-18 04:57:25 01832_memory_write_suffix: [ OK ] 0.68 sec.
2026-02-18 04:57:25 00753_alter_destination_for_storage_buffer: [ OK ] 0.98 sec.
2026-02-18 04:57:26 02784_schema_inference_null_as_default: [ OK ] 0.62 sec.
2026-02-18 04:57:26 00065_shard_float_literals_formatting: [ OK ] 0.79 sec.
2026-02-18 04:57:26 01906_bigint_accurate_cast_ubsan: [ OK ] 0.98 sec.
2026-02-18 04:57:26 01785_pmj_lc_bug: [ OK ] 0.88 sec.
2026-02-18 04:57:26 01245_limit_infinite_sources: [ OK ] 1.48 sec.
2026-02-18 04:57:27 02915_analyzer_fuzz_2: [ OK ] 0.73 sec.
2026-02-18 04:57:27 02510_group_by_prewhere_null: [ OK ] 0.78 sec.
2026-02-18 04:57:27 00980_zookeeper_merge_tree_alter_settings: [ OK ] 1.53 sec.
2026-02-18 04:57:27 02995_index_10: [ SKIPPED ] 0.00 sec.
2026-02-18 04:57:27 Reason: not running for current build
2026-02-18 04:57:28 03262_udf_in_constraint: [ OK ] 1.78 sec.
2026-02-18 04:57:28 01821_to_date_time_ubsan: [ OK ] 0.72 sec.
2026-02-18 04:57:29 03206_no_exceptions_clickhouse_local: [ FAIL ] 1.38 sec.
2026-02-18 04:57:29 Reason: return code: 134, result:
2026-02-18 04:57:29
2026-02-18 04:57:29
2026-02-18 04:57:29
2026-02-18 04:57:29 stdout:
2026-02-18 04:57:29
2026-02-18 04:57:29
2026-02-18 04:57:29 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 139927 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 5309940 --max_read_buffer_size 599248 --prefer_localhost_replica 1 --max_block_size 57012 --max_joined_block_size_rows 11130 --max_threads 2 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 87 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 34441008 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 4130214438 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 13 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 2903774649 --max_bytes_before_remerge_sort 1063157459 --min_compress_block_size 2818825 --max_compress_block_size 2589034 --merge_tree_compact_parts_min_granules_to_multibuffer_read 3 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 4792802 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.23 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 0 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1
2026-02-18 04:57:29
2026-02-18 04:57:29 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 2903863887 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 9442555977 --index_granularity_bytes 27979424 --merge_max_block_size 11750 --index_granularity 57651 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 39094 --primary_key_compress_block_size 70934 --replace_long_file_name_to_hash 1 --max_file_name_length 22 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 329597981 --compact_parts_max_granules_to_buffer 256 --compact_parts_merge_max_bytes_to_prefetch_part 28743149 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 23 --old_parts_lifetime 480
2026-02-18 04:57:29
2026-02-18 04:57:29 Database: test_5dfhvnsi
2026-02-18 04:57:29 00649_quantile_tdigest_negative: [ OK ] 0.68 sec.
2026-02-18 04:57:29 01147_partial_merge_full_join: [ OK ] 2.68 sec.
2026-02-18 04:57:29 01064_pm_all_join_const_and_nullable: [ OK ] 1.59 sec.
2026-02-18 04:57:29 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.94 sec.
2026-02-18 04:57:30 03032_variant_bool_number_not_suspicious: [ OK ] 0.68 sec.
2026-02-18 04:57:30 01660_join_or_inner: [ OK ] 1.23 sec.
2026-02-18 04:57:30 01710_projections_and_duplicate_columms: [ OK ] 0.83 sec.
2026-02-18 04:57:30 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.68 sec.
2026-02-18 04:57:30 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.78 sec.
2026-02-18 04:57:31 03289_explain_syntax_statistics: [ OK ] 0.67 sec.
2026-02-18 04:57:31 02356_insert_query_log_metrics: [ OK ] 1.13 sec.
2026-02-18 04:57:31 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.58 sec.
2026-02-18 04:57:31 01838_system_dictionaries_virtual_key_column: [ OK ] 1.03 sec.
2026-02-18 04:57:32 01125_dict_ddl_cannot_add_column: [ OK ] 0.62 sec.
2026-02-18 04:57:32 00975_recursive_materialized_view: [ OK ] 0.93 sec.
2026-02-18 04:57:32 01866_view_persist_settings: [ OK ] 1.43 sec.
2026-02-18 04:57:32 02922_respect_nulls_parser: [ OK ] 1.03 sec.
2026-02-18 04:57:32 03043_group_array_result_is_expected: [ OK ] 0.73 sec.
2026-02-18 04:57:33 00829_bitmap64_function: [ OK ] 1.18 sec.
2026-02-18 04:57:33 00105_shard_collations: [ OK ] 1.18 sec.
2026-02-18 04:57:33 02681_aggregation_by_partitions_bug: [ OK ] 0.73 sec.
2026-02-18 04:57:34 00637_sessions_in_http_interface_and_settings: [ OK ] 1.18 sec.
2026-02-18 04:57:34 02503_in_lc_const_args_bug: [ OK ] 0.63 sec.
2026-02-18 04:57:34 02970_visible_width_behavior: [ OK ] 0.73 sec.
2026-02-18 04:57:35 02900_matview_create_to_errors: [ OK ] 1.43 sec.
2026-02-18 04:57:35 01825_type_json_ephemeral: [ OK ] 0.78 sec.
2026-02-18 04:57:35 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 1.13 sec.
2026-02-18 04:57:36 01782_field_oom: [ OK ] 7.91 sec.
2026-02-18 04:57:36 01846_alter_column_without_type_bugfix: [ OK ] 0.58 sec.
2026-02-18 04:57:37 00673_subquery_prepared_set_performance: [ OK ] 1.43 sec.
2026-02-18 04:57:37 00652_replicated_mutations_zookeeper: [ OK ] 21.96 sec.
2026-02-18 04:57:37 01425_decimal_parse_big_negative_exponent: [ OK ] 1.03 sec.
2026-02-18 04:57:38 00152_totals_in_subquery: [ OK ] 0.63 sec.
2026-02-18 04:57:38 01903_http_fields: [ OK ] 2.88 sec.
2026-02-18 04:57:38 02243_ipv6_long_parsing: [ OK ] 0.73 sec.
2026-02-18 04:57:39 01301_polygons_within: [ OK ] 1.08 sec.
2026-02-18 04:57:39 00262_alter_alias: [ OK ] 0.93 sec.
2026-02-18 04:57:39 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 1.30 sec.
2026-02-18 04:57:39 01247_least_greatest_filimonov: [ OK ] 0.78 sec.
2026-02-18 04:57:40 03161_cnf_reduction: [ OK ] 0.97 sec.
2026-02-18 04:57:40 00843_optimize_predicate_and_rename_table: [ OK ] 0.73 sec.
2026-02-18 04:57:40 02971_functions_to_subcolumns_map: [ OK ] 0.93 sec.
2026-02-18 04:57:41 01040_dictionary_invalidate_query_switchover_long: [ OK ] 21.71 sec.
2026-02-18 04:57:41 02457_morton_coding: [ OK ] 1.58 sec.
2026-02-18 04:57:41 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.88 sec.
2026-02-18 04:57:42 02956_rocksdb_with_ttl: [ OK ] 3.74 sec.
2026-02-18 04:57:42 00580_consistent_hashing_functions: [ OK ] 0.78 sec.
2026-02-18 04:57:43 02982_unambiguous_alter_commands: [ OK ] 0.83 sec.
2026-02-18 04:57:43 00940_order_by_read_in_order_query_plan: [ OK ] 2.43 sec.
2026-02-18 04:57:43 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 1.53 sec.
2026-02-18 04:57:43 01076_json_each_row_array: [ OK ] 1.93 sec.
2026-02-18 04:57:44 01523_client_local_queries_file_parameter: [ OK ] 4.34 sec.
2026-02-18 04:57:44 00048_b_stored_aggregates_merge: [ OK ] 0.83 sec.
2026-02-18 04:57:45 01770_add_months_ubsan: [ OK ] 0.62 sec.
2026-02-18 04:57:46 02501_analyzer_expired_context_crash_fix: [ OK ] 0.78 sec.
2026-02-18 04:57:46 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 10.83 sec.
2026-02-18 04:57:46 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec.
2026-02-18 04:57:46 Reason: not running for current build
2026-02-18 04:57:46 01445_create_table_as_table_function: [ OK ] 3.04 sec.
2026-02-18 04:57:46 02798_generic_transform: [ OK ] 0.68 sec.
2026-02-18 04:57:47 02242_if_then_else_null_bug: [ OK ] 0.68 sec.
2026-02-18 04:57:47 01825_type_json_18: [ OK ] 0.78 sec.
2026-02-18 04:57:48 02122_parallel_formatting_Vertical: [ OK ] 5.65 sec.
2026-02-18 04:57:48 00335_bom: [ OK ] 1.38 sec.
2026-02-18 04:57:49 01939_network_receive_bytes_metrics: [ OK ] 4.34 sec.
2026-02-18 04:57:49 01710_normal_projections: [ OK ] 15.38 sec.
2026-02-18 04:57:50 00632_get_sample_block_cache: [ OK ] 4.79 sec.
2026-02-18 04:57:51 00362_great_circle_distance: [ OK ] 0.73 sec.
2026-02-18 04:57:52 02269_bool_map_sync_after_error: [ OK ] 8.41 sec.
2026-02-18 04:57:52 01308_orc_output_format_arrays: [ OK ] 4.59 sec.
2026-02-18 04:57:52 02920_alter_column_of_projections: [ OK ] 1.08 sec.
2026-02-18 04:57:53 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.93 sec.
2026-02-18 04:57:53 01231_operator_null_in: [ OK ] 4.00 sec.
2026-02-18 04:57:53 01470_columns_transformers: [ OK ] 0.98 sec.
2026-02-18 04:57:53 00823_capnproto_input: [ OK ] 4.29 sec.
2026-02-18 04:57:53 01318_alter_add_column_exists: [ OK ] 0.73 sec.
2026-02-18 04:57:53 00975_sample_prewhere_distributed: [ OK ] 0.83 sec.
2026-02-18 04:57:54 01774_bar_with_illegal_value: [ OK ] 0.58 sec.
2026-02-18 04:57:54 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.68 sec.
2026-02-18 04:57:55 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 1.33 sec.
2026-02-18 04:57:55 01050_engine_join_crash: [ OK ] 1.33 sec.
2026-02-18 04:57:55 01710_projection_row_policy: [ OK ] 1.53 sec.
2026-02-18 04:57:56 03153_format_regexp_usability: [ OK ] 3.04 sec.
2026-02-18 04:57:56 03022_alter_materialized_view_query_has_inner_table: [ OK ] 1.30 sec.
2026-02-18 04:57:57 00933_alter_ttl: [ OK ] 1.55 sec.
2026-02-18 04:57:57 01521_max_length_alias: [ OK ] 1.34 sec.
2026-02-18 04:57:57 02675_grant_query_formatting: [ OK ] 2.46 sec.
2026-02-18 04:57:58 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 9.41 sec.
2026-02-18 04:57:58 02112_skip_index_set_and_or: [ OK ] 0.79 sec.
2026-02-18 04:57:58 03015_with_fill_invalid_expression: [ OK ] 0.84 sec.
2026-02-18 04:57:59 02477_age: [ OK ] 2.00 sec.
2026-02-18 04:57:59 01528_setting_aggregate_functions_null_for_empty: [ OK ] 1.69 sec.
2026-02-18 04:57:59 01605_key_condition_enum_int: [ OK ] 0.85 sec.
2026-02-18 04:58:00 01825_new_type_json_3: [ OK ] 1.79 sec.
2026-02-18 04:58:00 02188_table_function_format: [ OK ] 0.99 sec.
2026-02-18 04:58:00 02844_max_backup_bandwidth_s3: [ OK ] 37.75 sec.
2026-02-18 04:58:01 02597_projection_materialize_and_replication: [ OK ] 2.10 sec.
2026-02-18 04:58:01 02514_tsv_zero_started_number: [ OK ] 0.68 sec.
2026-02-18 04:58:01 00037_totals_limit: [ OK ] 1.33 sec.
2026-02-18 04:58:03 02969_functions_to_subcolumns_if_null: [ OK ] 1.60 sec.
2026-02-18 04:58:05 00794_materialized_view_with_column_defaults: [ OK ] 1.45 sec.
2026-02-18 04:58:06 01262_low_cardinality_remove: [ OK ] 1.09 sec.
2026-02-18 04:58:08 02718_cli_dashed_options_parsing: [ OK ] 9.43 sec.
2026-02-18 04:58:09 02907_fromDaysSinceYearZero: [ OK ] 2.74 sec.
2026-02-18 04:58:10 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 9.47 sec.
2026-02-18 04:58:18 02346_into_outfile_and_stdout: [ OK ] 8.89 sec.
2026-02-18 04:58:18 02843_backup_use_same_password_for_base_backup: [ OK ] 18.35 sec.
2026-02-18 04:58:18 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 7.86 sec.
2026-02-18 04:58:19 01475_fix_bigint_shift: [ OK ] 1.44 sec.
2026-02-18 04:58:19 01666_lcm_ubsan: [ OK ] 1.80 sec.
2026-02-18 04:58:20 00623_truncate_table: [ OK ] 1.60 sec.
2026-02-18 04:58:21 03155_datasketches_ubsan: [ OK ] 1.55 sec.
2026-02-18 04:58:21 01848_partition_value_column: [ OK ] 1.49 sec.
2026-02-18 04:58:21 00700_decimal_defaults: [ OK ] 1.24 sec.
2026-02-18 04:58:22 01825_type_json_schema_inference: [ OK ] 13.87 sec.
2026-02-18 04:58:22 00623_replicated_truncate_table_zookeeper_long: [ OK ] 1.35 sec.
2026-02-18 04:58:22 03168_fuzz_multiIf_short_circuit: [ OK ] 1.21 sec.
2026-02-18 04:58:22 02377_analyzer_in_function_set: [ OK ] 1.04 sec.
2026-02-18 04:58:24 01710_minmax_count_projection_modify_partition_key: [ OK ] 1.40 sec.
2026-02-18 04:58:24 02481_xxh3_hash_function: [ OK ] 1.40 sec.
2026-02-18 04:58:24 02461_cancel_finish_race: [ OK ] 31.19 sec.
2026-02-18 04:58:25 01428_h3_range_check: [ OK ] 0.73 sec.
2026-02-18 04:58:25 02784_projections_read_in_order_bug: [ OK ] 0.82 sec.
2026-02-18 04:58:25 02915_analyzer_fuzz_6: [ OK ] 0.94 sec.
2026-02-18 04:58:26 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.83 sec.
2026-02-18 04:58:26 02428_delete_with_settings: [ OK ] 1.23 sec.
2026-02-18 04:58:27 00973_uniq_non_associativity: [ OK ] 1.89 sec.
2026-02-18 04:58:27 00232_format_readable_decimal_size: [ OK ] 0.73 sec.
2026-02-18 04:58:29 02876_yyyymmddtodate: [ OK ] 1.93 sec.
2026-02-18 04:58:30 02167_format_from_file_extension: [ OK ] 41.12 sec.
2026-02-18 04:58:30 00050_any_left_join: [ OK ] 0.73 sec.
2026-02-18 04:58:31 01049_join_low_card_crash: [ OK ] 0.83 sec.
2026-02-18 04:58:31 03159_dynamic_type_all_types: [ OK ] 1.03 sec.
2026-02-18 04:58:32 01802_formatDateTime_DateTime64_century: [ OK ] 0.83 sec.
2026-02-18 04:58:32 02859_replicated_db_name_zookeeper: [ OK ] 5.25 sec.
2026-02-18 04:58:32 01063_create_column_set: [ OK ] 0.68 sec.
2026-02-18 04:58:33 01894_jit_aggregation_function_max_long: [ OK ] 2.08 sec.
2026-02-18 04:58:33 02152_dictionary_date32_type: [ OK ] 0.83 sec.
2026-02-18 04:58:34 03015_optimize_final_rmt: [ OK ] 11.62 sec.
2026-02-18 04:58:34 02594_msgpack_more_types: [ OK ] 1.80 sec.
2026-02-18 04:58:34 01661_week_functions_string_args: [ OK ] 1.17 sec.
2026-02-18 04:58:34 00856_no_column_issue_4242: [ OK ] 0.79 sec.
2026-02-18 04:58:34 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.78 sec.
2026-02-18 04:58:35 01035_prewhere_with_alias: [ OK ] 0.77 sec.
2026-02-18 04:58:35 00192_least_greatest: [ OK ] 0.88 sec.
2026-02-18 04:58:36 01070_string_to_h3: [ OK ] 0.73 sec.
2026-02-18 04:58:36 01739_index_hint: [ OK ] 1.18 sec.
2026-02-18 04:58:36 02577_analyzer_array_join_calc_twice: [ OK ] 0.83 sec.
2026-02-18 04:58:37 01762_deltasumtimestamp: [ OK ] 0.83 sec.
2026-02-18 04:58:38 01514_parallel_formatting: [ OK ] 3.34 sec.
2026-02-18 04:58:38 00499_json_enum_insert: [ OK ] 0.63 sec.
2026-02-18 04:58:38 01791_dist_INSERT_block_structure_mismatch: [ OK ] 2.03 sec.
2026-02-18 04:58:38 02816_check_projection_metadata: [ OK ] 0.58 sec.
2026-02-18 04:58:39 03019_numbers_pretty: [ OK ] 0.73 sec.
2026-02-18 04:58:39 02402_merge_engine_with_view: [ OK ] 0.78 sec.
2026-02-18 04:58:39 02995_forget_partition: [ OK ] 13.48 sec.
2026-02-18 04:58:39 02473_extract_low_cardinality_from_json: [ OK ] 0.72 sec.
2026-02-18 04:58:40 00897_flatten: [ OK ] 0.78 sec.
2026-02-18 04:58:40 01025_array_compact_generic: [ OK ] 0.84 sec.
2026-02-18 04:58:40 02552_client_format_settings: [ OK ] 0.68 sec.
2026-02-18 04:58:40 02968_analyzer_join_column_not_found: [ OK ] 0.68 sec.
2026-02-18 04:58:40 00500_point_in_polygon: [ OK ] 1.23 sec.
2026-02-18 04:58:41 00931_low_cardinality_read_with_empty_array: [ OK ] 0.88 sec.
2026-02-18 04:58:41 00674_has_array_enum: [ OK ] 0.58 sec.
2026-02-18 04:58:41 02661_quantile_approx: [ OK ] 1.43 sec.
2026-02-18 04:58:41 01582_distinct_subquery_groupby: [ OK ] 0.93 sec.
2026-02-18 04:58:42 00688_aggregation_retention: [ OK ] 1.03 sec.
2026-02-18 04:58:42 02355_control_block_size_in_array_join: [ OK ] 0.84 sec.
2026-02-18 04:58:42 02815_first_line: [ OK ] 0.78 sec.
2026-02-18 04:58:42 00118_storage_join: [ OK ] 0.83 sec.
2026-02-18 04:58:43 02024_create_dictionary_with_comment: [ OK ] 0.58 sec.
2026-02-18 04:58:43 00127_group_by_concat: [ OK ] 0.68 sec.
2026-02-18 04:58:43 02201_use_skip_indexes_if_final: [ OK ] 0.93 sec.
2026-02-18 04:58:43 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.73 sec.
2026-02-18 04:58:43 03210_dynamic_squashing: [ OK ] 1.58 sec.
2026-02-18 04:58:44 03144_asof_join_ddb_doubles: [ OK ] 0.99 sec.
2026-02-18 04:58:45 02494_array_function_range: [ OK ] 0.83 sec.
2026-02-18 04:58:45 00552_or_nullable: [ OK ] 0.78 sec.
2026-02-18 04:58:46 02012_compress_lz4: [ OK ] 2.29 sec.
2026-02-18 04:58:46 01710_projections_group_by_no_key: [ OK ] 0.73 sec.
2026-02-18 04:58:47 03006_async_insert_deadlock_log: [ OK ] 3.49 sec.
2026-02-18 04:58:47 03057_analyzer_subquery_alias_join: [ OK ] 0.68 sec.
2026-02-18 04:58:47 02497_having_without_actual_aggregation_bug: [ OK ] 0.73 sec.
2026-02-18 04:58:48 00458_merge_type_cast: [ OK ] 1.84 sec.
2026-02-18 04:58:48 03169_cache_complex_dict_short_circuit_bug: [ OK ] 1.03 sec.
2026-02-18 04:58:48 02007_join_use_nulls: [ OK ] 0.88 sec.
2026-02-18 04:58:48 01493_table_function_null: [ OK ] 0.68 sec.
2026-02-18 04:58:49 00900_orc_arrays_load: [ OK ] 5.85 sec.
2026-02-18 04:58:49 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.83 sec.
2026-02-18 04:58:50 02751_query_log_test_partitions: [ OK ] 1.58 sec.
2026-02-18 04:58:50 01521_alter_enum_and_reverse_read: [ OK ] 0.77 sec.
2026-02-18 04:58:51 01273_arrow_stream: [ OK ] 50.43 sec.
2026-02-18 04:58:51 02592_avro_more_types: [ OK ] 1.84 sec.
2026-02-18 04:58:51 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 1.89 sec.
2026-02-18 04:58:51 00337_shard_any_heavy: [ OK ] 0.68 sec.
2026-02-18 04:58:51 01511_different_expression_with_same_alias: [ OK ] 0.83 sec.
2026-02-18 04:58:52 01715_table_function_view_fix: [ OK ] 0.58 sec.
2026-02-18 04:58:52 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.83 sec.
2026-02-18 04:58:52 02995_index_6: [ SKIPPED ] 0.00 sec.
2026-02-18 04:58:52 Reason: not running for current build
2026-02-18 04:58:52 03093_reading_bug_with_parallel_replicas: [ OK ] 1.03 sec.
2026-02-18 04:58:53 01018_ambiguous_column: [ OK ] 0.83 sec.
2026-02-18 04:58:53 02900_window_function_with_sparse_column: [ OK ] 0.98 sec.
2026-02-18 04:58:54 00626_replace_partition_from_table: [ OK ] 1.64 sec.
2026-02-18 04:58:55 01052_array_reduce_exception: [ OK ] 0.63 sec.
2026-02-18 04:58:56 03262_test_parquet_native_reader_int_logical_type: [ OK ] 2.69 sec.
2026-02-18 04:58:57 01024__getScalar: [ OK ] 0.73 sec.
2026-02-18 04:58:58 00996_limit_with_ties: [ OK ] 1.08 sec.
2026-02-18 04:58:58 01763_long_ttl_group_by: [ OK ] 3.19 sec.
2026-02-18 04:58:59 00709_virtual_column_partition_id: [ OK ] 0.77 sec.
2026-02-18 04:58:59 02706_kolmogorov_smirnov_test: [ OK ] 1.18 sec.
2026-02-18 04:59:00 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.84 sec.
2026-02-18 04:59:00 01098_msgpack_format: [ OK ] 38.01 sec.
2026-02-18 04:59:00 01547_query_log_current_database: [ OK ] 1.28 sec.
2026-02-18 04:59:01 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.73 sec.
2026-02-18 04:59:02 00030_alter_table: [ OK ] 1.23 sec.
2026-02-18 04:59:02 01865_aggregator_overflow_row: [ OK ] 0.88 sec.
2026-02-18 04:59:03 00002_system_numbers: [ OK ] 0.88 sec.
2026-02-18 04:59:03 02969_auto_format_detection: [ OK ] 29.54 sec.
2026-02-18 04:59:04 02352_interactive_queries_from_file: [ OK ] 1.98 sec.
2026-02-18 04:59:04 01014_function_repeat_corner_cases: [ OK ] 0.78 sec.
2026-02-18 04:59:04 00024_unused_array_join_in_subquery: [ OK ] 0.67 sec.
2026-02-18 04:59:04 02250_lots_of_columns_in_csv_with_names: [ OK ] 4.54 sec.
2026-02-18 04:59:05 03001_bad_error_message_higher_order_functions: [ OK ] 1.99 sec.
2026-02-18 04:59:05 02554_format_json_columns_for_empty: [ OK ] 0.72 sec.
2026-02-18 04:59:05 03036_test_parquet_bloom_filter_push_down: [ OK ] 17.04 sec.
2026-02-18 04:59:05 01499_log_deadlock: [ OK ] 0.88 sec.
2026-02-18 04:59:05 01825_type_json_nbagames: [ OK ] 13.42 sec.
2026-02-18 04:59:06 02232_partition_pruner_mixed_constant_type: [ OK ] 0.83 sec.
2026-02-18 04:59:06 00263_merge_aggregates_and_overflow: [ OK ] 0.74 sec.
2026-02-18 04:59:06 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.73 sec.
2026-02-18 04:59:06 02995_index_3: [ SKIPPED ] 0.00 sec.
2026-02-18 04:59:06 Reason: not running for current build
2026-02-18 04:59:07 01527_bad_aggregation_in_lambda: [ OK ] 0.57 sec.
2026-02-18 04:59:07 02345_filesystem_local: [ OK ] 1.43 sec.
2026-02-18 04:59:07 01736_null_as_default: [ OK ] 0.78 sec.
2026-02-18 04:59:07 02833_url_without_path_encoding: [ OK ] 2.74 sec.
2026-02-18 04:59:07 02149_issue_32487: [ OK ] 0.58 sec.
2026-02-18 04:59:08 02451_variadic_null_garbage_data: [ OK ] 1.08 sec.
2026-02-18 04:59:08 01621_sort_after_join_pipeline_stuck: [ OK ] 0.68 sec.
2026-02-18 04:59:08 01691_DateTime64_clamp: [ OK ] 0.93 sec.
2026-02-18 04:59:09 02835_join_step_explain: [ OK ] 0.93 sec.
2026-02-18 04:59:09 02692_multiple_joins_unicode: [ OK ] 0.93 sec.
2026-02-18 04:59:09 02002_system_table_with_tuple: [ OK ] 1.68 sec.
2026-02-18 04:59:09 02899_indexing_by_space_filling_curves: [ OK ] 1.43 sec.
2026-02-18 04:59:10 02150_replace_regexp_all_empty_match: [ OK ] 0.64 sec.
2026-02-18 04:59:10 00662_has_nullable: [ OK ] 0.89 sec.
2026-02-18 04:59:11 02751_multiquery_with_argument: [ OK ] 4.64 sec.
2026-02-18 04:59:12 03145_unicode_quotes: [ OK ] 0.68 sec.
2026-02-18 04:59:12 01268_procfs_metrics: [ OK ] 1.98 sec.
2026-02-18 04:59:12 02385_analyzer_aliases_compound_expression: [ OK ] 0.83 sec.
2026-02-18 04:59:13 00981_in_subquery_with_tuple: [ OK ] 7.80 sec.
2026-02-18 04:59:13 02030_function_mapContainsKeyLike: [ OK ] 0.93 sec.
2026-02-18 04:59:14 01196_max_parser_depth: [ OK ] 2.13 sec.
2026-02-18 04:59:14 01234_to_string_monotonic: [ OK ] 1.28 sec.
2026-02-18 04:59:15 00459_group_array_insert_at: [ OK ] 0.73 sec.
2026-02-18 04:59:15 02149_schema_inference_formats_with_schema_3: [ OK ] 5.09 sec.
2026-02-18 04:59:15 02373_datetime64_monotonicity: [ OK ] 5.64 sec.
2026-02-18 04:59:15 02661_read_from_archive_tzst: [ OK ] 23.76 sec.
2026-02-18 04:59:15 02013_emptystring_cast: [ OK ] 0.83 sec.
2026-02-18 04:59:16 01120_join_constants: [ OK ] 0.68 sec.
2026-02-18 04:59:16 02125_transform_decimal_bug: [ OK ] 0.82 sec.
2026-02-18 04:59:16 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.63 sec.
2026-02-18 04:59:16 01731_async_task_queue_wait: [ OK ] 2.93 sec.
2026-02-18 04:59:17 00538_datediff: [ OK ] 1.23 sec.
2026-02-18 04:59:17 01925_merge_prewhere_table: [ OK ] 0.73 sec.
2026-02-18 04:59:17 01821_join_table_mutation: [ OK ] 0.83 sec.
2026-02-18 04:59:17 02155_nested_lc_defalut_bug: [ OK ] 0.73 sec.
2026-02-18 04:59:18 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.68 sec.
2026-02-18 04:59:18 00952_insert_into_distributed_with_materialized_column: [ OK ] 1.48 sec.
2026-02-18 04:59:18 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.63 sec.
2026-02-18 04:59:18 02325_dates_schema_inference: [ OK ] 1.18 sec.
2026-02-18 04:59:18 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 4.29 sec.
2026-02-18 04:59:19 00434_tonullable: [ OK ] 0.63 sec.
2026-02-18 04:59:19 00538_datediff_plural_units: [ OK ] 0.78 sec.
2026-02-18 04:59:19 02469_interval_msan: [ OK ] 0.88 sec.
2026-02-18 04:59:19 01532_collate_in_low_cardinality: [ OK ] 0.88 sec.
2026-02-18 04:59:20 00957_neighbor: [ OK ] 1.18 sec.
2026-02-18 04:59:20 01685_ssd_cache_dictionary_complex_key: [ OK ] 2.23 sec.
2026-02-18 04:59:21 03035_dynamic_sorting: [ OK ] 1.18 sec.
2026-02-18 04:59:21 03167_fancy_quotes_off_by_one: [ OK ] 0.63 sec.
2026-02-18 04:59:22 02903_client_insert_in_background: [ OK ] 3.49 sec.
2026-02-18 04:59:22 02560_quantile_min_max: [ OK ] 0.68 sec.
2026-02-18 04:59:22 02013_bloom_filter_hasAll: [ OK ] 1.14 sec.
2026-02-18 04:59:22 02375_scalar_lc_cte: [ OK ] 0.52 sec.
2026-02-18 04:59:23 01085_extract_all_empty: [ OK ] 0.63 sec.
2026-02-18 04:59:23 01532_having_with_totals: [ OK ] 0.93 sec.
2026-02-18 04:59:23 02294_system_certificates: [ OK ] 0.68 sec.
2026-02-18 04:59:24 03087_analyzer_subquery_with_alias: [ OK ] 0.63 sec.
2026-02-18 04:59:24 01456_modify_column_type_via_add_drop_update: [ OK ] 1.50 sec.
2026-02-18 04:59:24 01081_window_view_target_table_engine: [ OK ] 4.85 sec.
2026-02-18 04:59:24 00696_system_columns_limit: [ OK ] 0.87 sec.
2026-02-18 04:59:24 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec.
2026-02-18 04:59:24 Reason: not running for current build
2026-02-18 04:59:25 03033_final_undefined_last_mark: [ OK ] 0.28 sec.
2026-02-18 04:59:25 03290_limit_by_segv: [ OK ] 0.68 sec.
2026-02-18 04:59:25 00260_like_and_curly_braces: [ OK ] 1.08 sec.
2026-02-18 04:59:26 03164_linestring_geometry: [ OK ] 0.63 sec.
2026-02-18 04:59:26 00753_distributed_system_columns_and_system_tables: [ OK ] 0.63 sec.
2026-02-18 04:59:26 00960_eval_ml_method_const: [ OK ] 0.63 sec.
2026-02-18 04:59:26 03093_special_column_errors: [ OK ] 1.23 sec.
2026-02-18 04:59:27 00098_j_union_all: [ OK ] 0.57 sec.
2026-02-18 04:59:27 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.73 sec.
2026-02-18 04:59:27 03156_analyzer_array_join_distributed: [ OK ] 0.98 sec.
2026-02-18 04:59:27 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.68 sec.
2026-02-18 04:59:28 03002_analyzer_prewhere: [ OK ] 0.87 sec.
2026-02-18 04:59:29 02999_variant_suspicious_types: [ OK ] 0.63 sec.
2026-02-18 04:59:30 02490_replacing_merge_tree_is_deleted_column: [ OK ] 2.43 sec.
2026-02-18 04:59:30 01580_column_const_comparision: [ OK ] 0.69 sec.
2026-02-18 04:59:30 03003_database_filesystem_format_detection: [ OK ] 3.28 sec.
2026-02-18 04:59:30 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.78 sec.
2026-02-18 04:59:31 02953_slow_create_view: [ OK ] 0.78 sec.
2026-02-18 04:59:31 02150_index_hypothesis_race_long: [ OK ] 11.16 sec.
2026-02-18 04:59:31 03093_bug_gcd_codec: [ OK ] 0.88 sec.
2026-02-18 04:59:32 01318_map_populate_series: [ OK ] 1.18 sec.
2026-02-18 04:59:32 02497_source_part_is_intact_when_mutation: [ OK ] 0.93 sec.
2026-02-18 04:59:33 02971_limit_by_distributed: [ OK ] 0.88 sec.
2026-02-18 04:59:33 01139_asof_join_types: [ OK ] 0.78 sec.
2026-02-18 04:59:33 03246_skipping_index_70108: [ OK ] 1.69 sec.
2026-02-18 04:59:33 02207_s3_content_type: [ OK ] 2.74 sec.
2026-02-18 04:59:33 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.78 sec.
2026-02-18 04:59:34 02916_replication_protocol_wait_for_part: [ OK ] 11.28 sec.
2026-02-18 04:59:34 00700_decimal_formats: [ OK ] 0.88 sec.
2026-02-18 04:59:35 02183_combinator_if: [ OK ] 1.49 sec.
2026-02-18 04:59:36 00500_point_in_polygon_non_const_poly: [ OK ] 2.19 sec.
2026-02-18 04:59:36 02477_invalid_reads: [ OK ] 1.78 sec.
2026-02-18 04:59:36 03152_dynamic_type_simple: [ OK ] 0.78 sec.
2026-02-18 04:59:37 02481_async_insert_dedup: [ OK ] 96.40 sec.
2026-02-18 04:59:37 02479_analyzer_aggregation_crash: [ OK ] 0.83 sec.
2026-02-18 04:59:38 02162_array_first_last_index: [ OK ] 0.93 sec.
2026-02-18 04:59:38 02513_prewhere_combine_step_filters: [ OK ] 1.18 sec.
2026-02-18 04:59:39 02890_describe_table_options: [ OK ] 0.73 sec.
2026-02-18 04:59:41 01544_file_engine_settings: [ OK ] 1.93 sec.
2026-02-18 04:59:41 02357_query_cancellation_race: [ OK ] 7.46 sec.
2026-02-18 04:59:42 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.62 sec.
2026-02-18 04:59:44 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 10.71 sec.
2026-02-18 04:59:44 00763_long_lock_buffer_alter_destination_table: [ OK ] 34.70 sec.
2026-02-18 04:59:45 02009_body_query_params: [ OK ] 1.23 sec.
2026-02-18 04:59:46 02555_davengers_rename_chain: [ OK ] 7.66 sec.
2026-02-18 04:59:47 01119_session_log: [ OK ] 31.79 sec.
2026-02-18 04:59:47 00287_column_const_with_nan: [ OK ] 0.63 sec.
2026-02-18 04:59:47 01307_orc_output_format: [ OK ] 5.39 sec.
2026-02-18 04:59:47 00901_joint_entropy: [ OK ] 0.73 sec.
2026-02-18 04:59:47 02516_projections_with_rollup: [ OK ] 3.64 sec.
2026-02-18 04:59:48 01013_hex_decimal: [ OK ] 0.73 sec.
2026-02-18 04:59:48 03032_storage_memory_modify_settings: [ OK ] 1.33 sec.
2026-02-18 04:59:48 00905_compile_expressions_compare_big_dates: [ OK ] 0.78 sec.
2026-02-18 04:59:49 03040_array_sum_and_join: [ OK ] 0.73 sec.
2026-02-18 04:59:49 03085_analyzer_alias_column_group_by: [ OK ] 0.63 sec.
2026-02-18 04:59:49 00450_higher_order_and_nullable: [ OK ] 0.53 sec.
2026-02-18 04:59:49 01655_window_functions_bug: [ OK ] 0.63 sec.
2026-02-18 04:59:50 01825_new_type_json_in_array: [ OK ] 1.54 sec.
2026-02-18 04:59:51 01107_join_right_table_totals: [ OK ] 1.34 sec.
2026-02-18 04:59:51 01942_dateTimeToSnowflake: [ OK ] 0.93 sec.
2026-02-18 04:59:51 02810_async_insert_dedup_replicated_collapsing: [ OK ] 15.79 sec.
2026-02-18 04:59:52 03013_position_const_start_pos: [ OK ] 0.63 sec.
2026-02-18 04:59:53 01058_zlib_ng_level1_bug: [ OK ] 5.54 sec.
2026-02-18 04:59:53 01549_low_cardinality_mv_fuzz: [ OK ] 0.73 sec.
2026-02-18 04:59:53 00507_array_no_params: [ OK ] 2.79 sec.
2026-02-18 04:59:54 01034_values_parse_float_bug: [ OK ] 4.79 sec.
2026-02-18 04:59:54 03210_empty_tuple_lhs_of_in: [ OK ] 0.73 sec.
2026-02-18 04:59:54 01086_window_view_cleanup: [ OK ] 9.31 sec.
2026-02-18 04:59:55 02842_table_function_file_filter_by_virtual_columns: [ OK ] 1.73 sec.
2026-02-18 04:59:55 02233_interpolate_1: [ OK ] 1.33 sec.
2026-02-18 04:59:55 03151_pmj_join_non_procssed_clash: [ OK ] 0.88 sec.
2026-02-18 04:59:55 01504_rocksdb: [ OK ] 3.99 sec.
2026-02-18 04:59:56 00088_distinct_of_arrays_of_strings: [ OK ] 0.62 sec.
2026-02-18 04:59:56 01010_pmj_on_disk: [ OK ] 0.88 sec.
2026-02-18 04:59:56 02251_alter_enum_nested_struct: [ OK ] 0.69 sec.
2026-02-18 04:59:56 01660_join_or_all: [ OK ] 1.73 sec.
2026-02-18 04:59:57 00779_all_right_join_max_block_size: [ OK ] 0.73 sec.
2026-02-18 04:59:57 02011_tuple_vector_functions: [ OK ] 1.93 sec.
2026-02-18 04:59:57 01603_remove_column_ttl: [ OK ] 0.73 sec.
2026-02-18 04:59:58 02886_binary_like: [ OK ] 1.03 sec.
2026-02-18 04:59:58 01073_bad_alter_partition: [ OK ] 0.88 sec.
2026-02-18 04:59:58 00927_asof_join_noninclusive: [ OK ] 0.98 sec.
2026-02-18 04:59:59 02966_nested_offsets_subcolumn: [ OK ] 1.63 sec.
2026-02-18 04:59:59 02293_h3_line: [ OK ] 1.03 sec.
2026-02-18 05:00:00 02724_persist_interval_type: [ OK ] 0.93 sec.
2026-02-18 05:00:00 01611_string_to_low_cardinality_key_alter: [ OK ] 0.88 sec.
2026-02-18 05:00:00 02294_floating_point_second_in_settings: [ OK ] 5.75 sec.
2026-02-18 05:00:00 02588_avro_date32_and_decimals: [ OK ] 2.69 sec.
2026-02-18 05:00:01 02292_nested_not_flattened_detach: [ OK ] 0.63 sec.
2026-02-18 05:00:01 00432_aggregate_function_scalars_and_constants: [ OK ] 1.03 sec.
2026-02-18 05:00:01 01656_ipv4_bad_formatting: [ OK ] 0.78 sec.
2026-02-18 05:00:02 01300_svg: [ OK ] 1.43 sec.
2026-02-18 05:00:02 03261_json_hints_types_check: [ OK ] 0.98 sec.
2026-02-18 05:00:02 01533_distinct_depends_on_max_threads: [ OK ] 1.33 sec.
2026-02-18 05:00:03 00090_union_race_conditions_1: [ OK ] 21.95 sec.
2026-02-18 05:00:03 01548_with_totals_having: [ OK ] 0.78 sec.
2026-02-18 05:00:03 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.93 sec.
2026-02-18 05:00:04 00712_prewhere_with_final: [ OK ] 0.93 sec.
2026-02-18 05:00:04 00999_join_on_expression: [ OK ] 1.38 sec.
2026-02-18 05:00:07 02157_readonly_system_suspend: [ OK ] 2.89 sec.
2026-02-18 05:00:08 00449_filter_array_nullable_tuple: [ OK ] 1.09 sec.
2026-02-18 05:00:09 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 16.11 sec.
2026-02-18 05:00:10 02961_analyzer_low_cardinality_fuzzer: [ OK ] 1.30 sec.
2026-02-18 05:00:11 01473_system_events_zeroes: [ OK ] 0.94 sec.
2026-02-18 05:00:12 02883_zookeeper_finalize_stress: [ OK ] 9.49 sec.
2026-02-18 05:00:12 01951_distributed_push_down_limit: [ OK ] 0.85 sec.
2026-02-18 05:00:13 03115_alias_exists_column: [ OK ] 0.63 sec.
2026-02-18 05:00:13 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 15.19 sec.
2026-02-18 05:00:14 01825_new_type_json_12: [ OK ] 10.77 sec.
2026-02-18 05:00:14 02476_fix_lambda_parsing: [ OK ] 1.48 sec.
2026-02-18 05:00:15 01284_view_and_extremes_bug: [ OK ] 0.78 sec.
2026-02-18 05:00:15 02023_storage_filelog: [ OK ] 15.00 sec.
2026-02-18 05:00:15 02475_analyzer_join_tree_subquery: [ OK ] 0.73 sec.
2026-02-18 05:00:16 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.72 sec.
2026-02-18 05:00:16 02354_read_in_order_prewhere: [ OK ] 2.28 sec.
2026-02-18 05:00:16 00956_join_use_nulls_with_array_column: [ OK ] 0.72 sec.
2026-02-18 05:00:17 02122_parallel_formatting_TSVWithNames: [ OK ] 4.94 sec.
2026-02-18 05:00:17 01527_materialized_view_stack_overflow: [ OK ] 2.59 sec.
2026-02-18 05:00:17 01508_query_obfuscator: [ OK ] 1.38 sec.
2026-02-18 05:00:18 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.13 sec.
2026-02-18 05:00:18 02346_position_countsubstrings_zero_byte: [ OK ] 0.93 sec.
2026-02-18 05:00:18 02998_http_redirects: [ OK ] 1.23 sec.
2026-02-18 05:00:19 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.83 sec.
2026-02-18 05:00:19 01453_normalize_query_alias_uuid: [ OK ] 0.58 sec.
2026-02-18 05:00:19 03201_avro_negative_block_size_arrays: [ OK ] 1.78 sec.
2026-02-18 05:00:20 02006_todatetime64_from_string: [ OK ] 0.73 sec.
2026-02-18 05:00:20 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 1.03 sec.
2026-02-18 05:00:21 03033_cte_numbers_memory: [ OK ] 0.68 sec.
2026-02-18 05:00:21 01017_tuplehamming_distance: [ OK ] 0.78 sec.
2026-02-18 05:00:22 02982_dont_infer_exponent_floats: [ OK ] 0.62 sec.
2026-02-18 05:00:22 02366_window_function_order_by: [ OK ] 0.73 sec.
2026-02-18 05:00:22 01279_empty_external_table: [ OK ] 3.04 sec.
2026-02-18 05:00:22 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 4.74 sec.
2026-02-18 05:00:22 02737_sql_auto_is_null: [ OK ] 0.73 sec.
2026-02-18 05:00:23 02407_array_element_from_map_wrong_type: [ OK ] 0.68 sec.
2026-02-18 05:00:23 00113_shard_group_array: [ OK ] 7.68 sec.
2026-02-18 05:00:23 03014_msan_parse_date_time: [ OK ] 0.93 sec.
2026-02-18 05:00:23 02971_functions_to_subcolumns_variant: [ OK ] 0.83 sec.
2026-02-18 05:00:24 01450_set_null_const: [ OK ] 0.73 sec.
2026-02-18 05:00:24 01326_build_id: [ OK ] 0.68 sec.
2026-02-18 05:00:24 02831_trash: [ OK ] 0.73 sec.
2026-02-18 05:00:25 03164_early_constant_folding_analyzer: [ OK ] 0.83 sec.
2026-02-18 05:00:25 00231_format_vertical_raw: [ OK ] 0.68 sec.
2026-02-18 05:00:25 01780_column_sparse_pk: [ OK ] 1.18 sec.
2026-02-18 05:00:26 02227_union_match_by_name: [ OK ] 0.73 sec.
2026-02-18 05:00:26 02974_analyzer_array_join_subcolumn: [ OK ] 0.88 sec.
2026-02-18 05:00:27 02815_join_algorithm_setting: [ OK ] 2.29 sec.
2026-02-18 05:00:28 02480_tets_show_full: [ OK ] 2.54 sec.
2026-02-18 05:00:28 02579_parameterized_replace: [ OK ] 0.74 sec.
2026-02-18 05:00:29 01784_parallel_formatting_memory: [ OK ] 0.93 sec.
2026-02-18 05:00:30 01077_mutations_index_consistency: [ OK ] 7.80 sec.
2026-02-18 05:00:30 00191_aggregating_merge_tree_and_final: [ OK ] 0.93 sec.
2026-02-18 05:00:31 00927_disable_hyperscan: [ OK ] 0.98 sec.
2026-02-18 05:00:31 02908_filesystem_cache_as_collection: [ OK ] 0.63 sec.
2026-02-18 05:00:32 00177_inserts_through_http_parts: [ OK ] 1.48 sec.
2026-02-18 05:00:32 00054_join_string: [ OK ] 0.73 sec.
2026-02-18 05:00:33 01456_low_cardinality_sorting_bugfix: [ OK ] 0.93 sec.
2026-02-18 05:00:33 01532_tuple_with_name_type: [ OK ] 0.83 sec.
2026-02-18 05:00:33 01648_mutations_and_escaping: [ OK ] 4.95 sec.
2026-02-18 05:00:33 01780_range_msan: [ OK ] 0.63 sec.
2026-02-18 05:00:34 00945_bloom_filter_index: [ OK ] 7.71 sec.
2026-02-18 05:00:34 02915_analyzer_fuzz_5: [ OK ] 0.73 sec.
2026-02-18 05:00:34 02783_parsedatetimebesteffort_syslog: [ OK ] 0.73 sec.
2026-02-18 05:00:34 01416_clear_column_pk: [ OK ] 0.83 sec.
2026-02-18 05:00:35 00978_ml_math: [ OK ] 0.88 sec.
2026-02-18 05:00:35 02887_format_readable_timedelta_subseconds: [ OK ] 0.98 sec.
2026-02-18 05:00:35 02154_bit_slice_for_fixedstring: [ OK ] 2.18 sec.
2026-02-18 05:00:35 02428_combinators_with_over_statement: [ OK ] 0.78 sec.
2026-02-18 05:00:36 03246_alter_update_dynamic_hung: [ OK ] 0.73 sec.
2026-02-18 05:00:36 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.68 sec.
2026-02-18 05:00:36 02868_operator_is_not_distinct_from_priority: [ OK ] 0.73 sec.
2026-02-18 05:00:36 01013_hex_float: [ OK ] 0.83 sec.
2026-02-18 05:00:37 00122_join_with_subquery_with_subquery: [ OK ] 0.68 sec.
2026-02-18 05:00:37 01663_aes_msan: [ OK ] 0.68 sec.
2026-02-18 05:00:37 01766_todatetime64_no_timezone_arg: [ OK ] 0.73 sec.
2026-02-18 05:00:37 00472_create_view_if_not_exists: [ OK ] 0.57 sec.
2026-02-18 05:00:38 00647_select_numbers_with_offset: [ OK ] 0.63 sec.
2026-02-18 05:00:38 01338_long_select_and_alter: [ OK ] 16.34 sec.
2026-02-18 05:00:39 02551_obfuscator_keywords: [ OK ] 1.43 sec.
2026-02-18 05:00:39 03199_fix_auc_tie_handling: [ OK ] 0.73 sec.
2026-02-18 05:00:40 00746_sql_fuzzy: [ OK ] 63.94 sec.
2026-02-18 05:00:40 02538_analyzer_create_table_as_select: [ OK ] 0.79 sec.
2026-02-18 05:00:40 02815_no_throw_in_simple_queries: [ FAIL ] 4.25 sec.
2026-02-18 05:00:40 Reason: return code: 1
2026-02-18 05:00:40 send: spawn id exp3 not open
2026-02-18 05:00:40 while executing
2026-02-18 05:00:40 "send -- "exit\r""
2026-02-18 05:00:40 , result:
2026-02-18 05:00:40
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40
2026-02-18 05:00:40 stdout:
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40 Failed
2026-02-18 05:00:40
2026-02-18 05:00:40
2026-02-18 05:00:40 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 449712 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 7327236 --max_read_buffer_size 772422 --prefer_localhost_replica 0 --max_block_size 68062 --max_joined_block_size_rows 89850 --max_threads 2 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 76 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 17331276 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 3534353729 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 12 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1016323851 --min_compress_block_size 1452142 --max_compress_block_size 780323 --merge_tree_compact_parts_min_granules_to_multibuffer_read 126 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 7878809 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Antarctica/Troll --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.49 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0
2026-02-18 05:00:40
2026-02-18 05:00:40 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 7732177941 --index_granularity_bytes 8965547 --merge_max_block_size 5605 --index_granularity 8046 --min_bytes_for_wide_part 59005241 --marks_compress_block_size 70965 --primary_key_compress_block_size 38193 --replace_long_file_name_to_hash 1 --max_file_name_length 128 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 357639424 --compact_parts_max_granules_to_buffer 91 --compact_parts_merge_max_bytes_to_prefetch_part 15012982 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 0 --old_parts_lifetime 327
2026-02-18 05:00:40
2026-02-18 05:00:40 Database: test_j1ln0elw
2026-02-18 05:00:40 01497_mutation_support_for_storage_memory: [ OK ] 0.73 sec.
2026-02-18 05:00:41 00082_append_trailing_char_if_absent: [ OK ] 0.83 sec.
2026-02-18 05:00:41 02941_variant_type_1: [ OK ] 36.74 sec.
2026-02-18 05:00:41 00334_column_aggregate_function_limit: [ OK ] 0.70 sec.
2026-02-18 05:00:42 03151_dynamic_type_scale_max_types: [ OK ] 0.93 sec.
2026-02-18 05:00:42 02319_dict_get_check_arguments_size: [ OK ] 0.88 sec.
2026-02-18 05:00:42 02903_bug_43644: [ OK ] 0.79 sec.
2026-02-18 05:00:42 01030_limit_by_with_ties_error: [ OK ] 3.59 sec.
2026-02-18 05:00:42 03054_analyzer_join_alias: [ OK ] 0.63 sec.
2026-02-18 05:00:43 01817_storage_buffer_parameters: [ OK ] 0.73 sec.
2026-02-18 05:00:43 00143_number_classification_functions: [ OK ] 0.93 sec.
2026-02-18 05:00:43 02295_GROUP_BY_AggregateFunction: [ OK ] 0.78 sec.
2026-02-18 05:00:43 00149_function_url_hash: [ OK ] 0.97 sec.
2026-02-18 05:00:44 01890_state_of_state: [ OK ] 1.08 sec.
2026-02-18 05:00:44 02541_empty_function_support_ip: [ OK ] 0.78 sec.
2026-02-18 05:00:44 01786_group_by_pk_many_streams: [ OK ] 1.24 sec.
2026-02-18 05:00:45 00936_crc_functions: [ OK ] 0.83 sec.
2026-02-18 05:00:45 01825_type_json_8: [ OK ] 7.22 sec.
2026-02-18 05:00:45 02864_filtered_url_with_globs: [ OK ] 0.83 sec.
2026-02-18 05:00:45 03034_dynamic_conversions: [ OK ] 1.23 sec.
2026-02-18 05:00:46 02785_global_join_too_many_columns: [ OK ] 0.83 sec.
2026-02-18 05:00:46 03038_move_partition_to_oneself_deadlock: [ OK ] 0.83 sec.
2026-02-18 05:00:46 01220_scalar_optimization_in_alter: [ OK ] 0.78 sec.
2026-02-18 05:00:47 00554_nested_and_table_engines: [ OK ] 1.18 sec.
2026-02-18 05:00:47 00997_trim: [ OK ] 1.43 sec.
2026-02-18 05:00:48 03276_functions_to_subcolumns_lc: [ OK ] 0.88 sec.
2026-02-18 05:00:49 00181_aggregate_functions_statistics_stable: [ OK ] 1.23 sec.
2026-02-18 05:00:49 02470_suspicious_low_cardinality_msan: [ OK ] 0.88 sec.
2026-02-18 05:00:50 02963_remote_read_small_buffer_size_bug: [ OK ] 12.58 sec.
2026-02-18 05:00:50 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 1.13 sec.
2026-02-18 05:00:50 01014_format_custom_separated: [ OK ] 6.65 sec.
2026-02-18 05:00:51 01415_sticking_mutations: [ OK ] 42.63 sec.
2026-02-18 05:00:51 01054_random_printable_ascii_ubsan: [ OK ] 5.35 sec.
2026-02-18 05:00:51 00700_decimal_math: [ OK ] 1.13 sec.
2026-02-18 05:00:51 00607_index_in_in: [ OK ] 0.83 sec.
2026-02-18 05:00:51 00956_http_prepared_statements: [ OK ] 1.43 sec.
2026-02-18 05:00:51 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 2.89 sec.
2026-02-18 05:00:52 02494_parser_string_binary_literal: [ OK ] 0.77 sec.
2026-02-18 05:00:52 02181_dictionary_attach_detach: [ OK ] 0.98 sec.
2026-02-18 05:00:52 01596_setting_limit_offset: [ OK ] 0.93 sec.
2026-02-18 05:00:52 01082_bit_test_out_of_bound: [ OK ] 0.93 sec.
2026-02-18 05:00:52 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.68 sec.
2026-02-18 05:00:52 00534_functions_bad_arguments11: [ SKIPPED ] 0.00 sec.
2026-02-18 05:00:52 Reason: not running for current build
2026-02-18 05:00:53 02687_native_fuzz: [ OK ] 0.68 sec.
2026-02-18 05:00:53 00800_function_java_hash: [ OK ] 0.98 sec.
2026-02-18 05:00:53 01475_read_subcolumns_2: [ OK ] 0.98 sec.
2026-02-18 05:00:53 02946_literal_alias_misclassification: [ OK ] 0.72 sec.
2026-02-18 05:00:53 01670_log_comment: [ OK ] 1.18 sec.
2026-02-18 05:00:54 00060_date_lut: [ OK ] 0.68 sec.
2026-02-18 05:00:54 03217_datetime64_constant_to_ast: [ OK ] 0.88 sec.
2026-02-18 05:00:54 01010_pmj_skip_blocks: [ OK ] 2.23 sec.
2026-02-18 05:00:54 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.99 sec.
2026-02-18 05:00:55 02464_decimal_scale_buffer_overflow: [ OK ] 0.74 sec.
2026-02-18 05:00:55 02243_make_date32_mysql: [ OK ] 1.18 sec.
2026-02-18 05:00:55 02206_format_override: [ OK ] 2.58 sec.
2026-02-18 05:00:56 02245_s3_virtual_columns: [ OK ] 0.88 sec.
2026-02-18 05:00:56 02539_vertical_merge_compact_parts: [ OK ] 2.08 sec.
2026-02-18 05:00:56 00814_parsing_ub: [ OK ] 0.68 sec.
2026-02-18 05:00:57 01788_update_nested_type_subcolumn_check: [ OK ] 1.59 sec.
2026-02-18 05:00:57 01182_materialized_view_different_structure: [ OK ] 1.43 sec.
2026-02-18 05:00:57 02842_one_input_format: [ OK ] 4.19 sec.
2026-02-18 05:00:58 01780_column_sparse_filter: [ OK ] 0.98 sec.
2026-02-18 05:00:58 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.78 sec.
2026-02-18 05:00:58 00999_nullable_nested_types_4877: [ OK ] 0.98 sec.
2026-02-18 05:00:59 01652_ttl_old_syntax: [ OK ] 0.67 sec.
2026-02-18 05:00:59 01272_offset_without_limit: [ OK ] 0.78 sec.
2026-02-18 05:00:59 01657_test_toHour_mysql_compatibility: [ OK ] 0.73 sec.
2026-02-18 05:00:59 01376_array_fill_empty: [ OK ] 0.62 sec.
2026-02-18 05:01:00 03023_remove_unused_column_distinct: [ OK ] 0.58 sec.
2026-02-18 05:01:04 02480_client_option_print_num_processed_rows: [ OK ] 5.20 sec.
2026-02-18 05:01:05 03150_dynamic_type_mv_insert: [ OK ] 1.24 sec.
2026-02-18 05:01:06 00679_uuid_in_key: [ OK ] 1.03 sec.
2026-02-18 05:01:06 02550_client_connections_credentials: [ OK ] 20.73 sec.
2026-02-18 05:01:07 01662_join_mixed: [ OK ] 0.89 sec.
2026-02-18 05:01:07 03258_old_analyzer_const_expr_bug: [ OK ] 0.80 sec.
2026-02-18 05:01:08 00429_point_in_ellipses: [ OK ] 0.73 sec.
2026-02-18 05:01:09 02343_aggregation_pipeline: [ OK ] 1.19 sec.
2026-02-18 05:01:10 02412_nlp: [ OK ] 0.96 sec.
2026-02-18 05:01:10 01890_jit_aggregation_function_sum_long: [ OK ] 2.27 sec.
2026-02-18 05:01:10 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.73 sec.
2026-02-18 05:01:12 00612_count: [ OK ] 1.19 sec.
2026-02-18 05:01:12 01323_redundant_functions_in_order_by: [ OK ] 1.55 sec.
2026-02-18 05:01:12 02124_buffer_with_type_map_long: [ OK ] 13.12 sec.
2026-02-18 05:01:12 02813_func_now_and_alias: [ OK ] 0.78 sec.
2026-02-18 05:01:13 02177_sum_if_not_found: [ OK ] 0.83 sec.
2026-02-18 05:01:13 02916_set_formatting: [ OK ] 0.53 sec.
2026-02-18 05:01:13 00688_low_cardinality_in: [ OK ] 0.88 sec.
2026-02-18 05:01:13 00534_functions_bad_arguments8: [ SKIPPED ] 0.00 sec.
2026-02-18 05:01:13 Reason: not running for current build
2026-02-18 05:01:14 00846_join_using_tuple_crash: [ OK ] 0.63 sec.
2026-02-18 05:01:14 03641_analyzer_issue_85834: [ OK ] 0.73 sec.
2026-02-18 05:01:14 00702_join_on_dups: [ OK ] 1.58 sec.
2026-02-18 05:01:15 01505_log_distributed_deadlock: [ OK ] 0.73 sec.
2026-02-18 05:01:15 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec.
2026-02-18 05:01:15 Reason: not running for current build
2026-02-18 05:01:15 00564_initial_column_values_with_default_expression: [ OK ] 0.78 sec.
2026-02-18 05:01:16 01406_carriage_return_in_tsv_csv: [ OK ] 3.14 sec.
2026-02-18 05:01:17 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 16.76 sec.
2026-02-18 05:01:17 03041_dynamic_type_check_table: [ OK ] 20.18 sec.
2026-02-18 05:01:17 00522_multidimensional: [ OK ] 1.58 sec.
2026-02-18 05:01:17 02310_generate_multi_columns_with_uuid: [ OK ] 0.63 sec.
2026-02-18 05:01:17 01107_tuples_arrays_parsing_exceptions: [ OK ] 2.23 sec.
2026-02-18 05:01:17 02316_values_table_func_bug: [ OK ] 0.68 sec.
2026-02-18 05:01:18 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.73 sec.
2026-02-18 05:01:18 01073_show_tables_not_like: [ OK ] 0.83 sec.
2026-02-18 05:01:18 02989_variant_comparison: [ OK ] 1.39 sec.
2026-02-18 05:01:18 02715_or_null: [ OK ] 0.68 sec.
2026-02-18 05:01:18 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.72 sec.
2026-02-18 05:01:18 02480_suspicious_lowcard_in_key: [ OK ] 0.68 sec.
2026-02-18 05:01:19 01040_distributed_background_insert_batch_inserts: [ OK ] 1.08 sec.
2026-02-18 05:01:19 02096_date_time_1970_saturation: [ OK ] 1.08 sec.
2026-02-18 05:01:20 03246_json_tuple_decompress_race: [ OK ] 1.48 sec.
2026-02-18 05:01:20 01427_pk_and_expression_with_different_type: [ OK ] 0.72 sec.
2026-02-18 05:01:21 00311_array_primary_key: [ OK ] 0.83 sec.
2026-02-18 05:01:21 02875_show_functions: [ OK ] 3.23 sec.
2026-02-18 05:01:21 01273_arrow: [ OK ] 41.34 sec.
2026-02-18 05:01:22 02990_optimize_uniq_to_count_alias: [ OK ] 0.73 sec.
2026-02-18 05:01:22 02901_remove_nullable_crash_analyzer: [ OK ] 0.78 sec.
2026-02-18 05:01:23 02875_merge_engine_set_index: [ OK ] 3.89 sec.
2026-02-18 05:01:24 02811_invalid_embedded_rocksdb_create: [ OK ] 0.67 sec.
2026-02-18 05:01:25 01605_drop_settings_profile_while_assigned: [ OK ] 0.84 sec.
2026-02-18 05:01:26 00701_join_default_strictness: [ OK ] 0.83 sec.
2026-02-18 05:01:27 02539_settings_alias: [ OK ] 6.87 sec.
2026-02-18 05:01:27 02475_precise_decimal_arithmetics: [ OK ] 1.28 sec.
2026-02-18 05:01:28 02192_comment: [ OK ] 0.73 sec.
2026-02-18 05:01:28 01451_wrong_error_long_query: [ OK ] 1.28 sec.
2026-02-18 05:01:29 01410_full_join_and_null_predicates: [ OK ] 1.04 sec.
2026-02-18 05:01:29 02260_alter_compact_part_drop_nested_column: [ OK ] 0.94 sec.
2026-02-18 05:01:30 00530_arrays_of_nothing: [ OK ] 0.78 sec.
2026-02-18 05:01:32 03221_merge_profile_events: [ OK ] 2.34 sec.
2026-02-18 05:01:33 01548_uncomparable_columns_in_keys: [ OK ] 0.68 sec.
2026-02-18 05:01:33 01444_create_table_drop_database_race: [ OK ] 11.78 sec.
2026-02-18 05:01:34 02734_big_int_from_float_ubsan: [ OK ] 0.67 sec.
2026-02-18 05:01:34 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 1.33 sec.
2026-02-18 05:01:35 02118_deserialize_whole_text: [ OK ] 13.19 sec.
2026-02-18 05:01:35 00384_column_aggregate_function_insert_from: [ OK ] 0.88 sec.
2026-02-18 05:01:36 01374_if_nullable_filimonov: [ OK ] 0.68 sec.
2026-02-18 05:01:36 01354_order_by_tuple_collate_const: [ OK ] 0.68 sec.
2026-02-18 05:01:36 00159_whitespace_in_columns_list: [ OK ] 0.73 sec.
2026-02-18 05:01:37 00804_test_custom_compression_codecs: [ OK ] 1.63 sec.
2026-02-18 05:01:38 01599_multiline_input_and_singleline_comments: [ OK ] 1.28 sec.
2026-02-18 05:01:38 00825_protobuf_format_array_3dim: [ OK ] 4.29 sec.
2026-02-18 05:01:38 02923_join_use_nulls_modulo: [ OK ] 0.73 sec.
2026-02-18 05:01:39 00488_column_name_primary: [ OK ] 0.68 sec.
2026-02-18 05:01:40 00161_rounding_functions: [ OK ] 1.30 sec.
2026-02-18 05:01:41 02042_map_get_non_const_key: [ OK ] 0.73 sec.
2026-02-18 05:01:42 02221_parallel_replicas_bug: [ OK ] 4.30 sec.
2026-02-18 05:01:43 01395_limit_more_cases: [ OK ] 48.37 sec.
2026-02-18 05:01:44 00402_nan_and_extremes: [ OK ] 0.83 sec.
2026-02-18 05:01:45 03325_distributed_join_json_array_subcolumns: [ OK ] 0.83 sec.
2026-02-18 05:01:46 01651_lc_insert_tiny_log_3: [ OK ] 7.41 sec.
2026-02-18 05:01:46 02730_with_fill_by_sorting_prefix: [ OK ] 1.30 sec.
2026-02-18 05:01:46 02317_functions_with_nothing: [ OK ] 0.78 sec.
2026-02-18 05:01:47 00400_client_external_options: [ OK ] 4.59 sec.
2026-02-18 05:01:47 02950_part_log_bytes_uncompressed: [ OK ] 1.04 sec.
2026-02-18 05:01:47 00820_multiple_joins_subquery_requires_alias: [ OK ] 1.13 sec.
2026-02-18 05:01:47 02280_add_query_level_settings: [ OK ] 0.86 sec.
2026-02-18 05:01:48 02426_to_string_nullable_fixedstring: [ OK ] 0.63 sec.
2026-02-18 05:01:48 01812_has_generic: [ OK ] 0.84 sec.
2026-02-18 05:01:49 01902_table_function_merge_db_params: [ OK ] 1.03 sec.
2026-02-18 05:01:49 00229_prewhere_column_missing: [ OK ] 0.98 sec.
2026-02-18 05:01:49 03033_lightweight_deletes_sync: [ OK ] 0.98 sec.
2026-02-18 05:01:50 01055_compact_parts_1: [ OK ] 0.84 sec.
2026-02-18 05:01:50 01621_clickhouse_compressor: [ OK ] 1.64 sec.
2026-02-18 05:01:50 02384_analyzer_dict_get_join_get: [ OK ] 0.98 sec.
2026-02-18 05:01:51 00622_select_in_parens: [ OK ] 0.78 sec.
2026-02-18 05:01:51 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.89 sec.
2026-02-18 05:01:52 02871_clickhouse_client_restart_pager: [ OK ] 1.73 sec.
2026-02-18 05:01:52 01702_toDateTime_from_string_clamping: [ OK ] 0.73 sec.
2026-02-18 05:01:53 01632_tinylog_read_write: [ OK ] 11.73 sec.
2026-02-18 05:01:53 01071_in_array: [ OK ] 0.68 sec.
2026-02-18 05:01:53 01328_bad_peephole_optimization: [ OK ] 0.68 sec.
2026-02-18 05:01:53 01059_storage_file_compression: [ OK ] 31.50 sec.
2026-02-18 05:01:53 02771_if_constant_folding: [ OK ] 0.78 sec.
2026-02-18 05:01:54 02125_fix_storage_filelog: [ OK ] 0.58 sec.
2026-02-18 05:01:54 02346_to_hour_monotonicity_fix: [ OK ] 0.73 sec.
2026-02-18 05:01:54 01358_constexpr_constraint: [ OK ] 0.68 sec.
2026-02-18 05:01:55 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.63 sec.
2026-02-18 05:01:55 00411_long_accurate_number_comparison_int2: [ OK ] 25.83 sec.
2026-02-18 05:01:55 00267_tuple_array_access_operators_priority: [ OK ] 0.62 sec.
2026-02-18 05:01:55 02366_kql_func_math: [ OK ] 1.03 sec.
2026-02-18 05:01:55 01518_nullable_aggregate_states1: [ OK ] 0.98 sec.
2026-02-18 05:01:55 00534_functions_bad_arguments2: [ SKIPPED ] 0.00 sec.
2026-02-18 05:01:55 Reason: not running for current build
2026-02-18 05:01:56 01506_buffer_table_alter_block_structure: [ OK ] 0.78 sec.
2026-02-18 05:01:56 00007_array: [ OK ] 0.63 sec.
2026-02-18 05:01:56 01165_lost_part_empty_partition: [ OK ] 5.06 sec.
2026-02-18 05:01:56 00876_wrong_arraj_join_column: [ OK ] 0.69 sec.
2026-02-18 05:01:56 00700_decimal_in_keys: [ OK ] 0.88 sec.
2026-02-18 05:01:57 00685_output_format_json_escape_forward_slashes: [ OK ] 0.67 sec.
2026-02-18 05:01:57 01010_partial_merge_join_const_and_lc: [ OK ] 0.93 sec.
2026-02-18 05:01:57 00825_http_header_query_id: [ OK ] 1.18 sec.
2026-02-18 05:01:57 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.73 sec.
2026-02-18 05:01:57 01019_alter_materialized_view_atomic: [ SKIPPED ] 0.00 sec.
2026-02-18 05:01:57 Reason: not running for current build
2026-02-18 05:01:58 00606_quantiles_and_nans: [ OK ] 0.63 sec.
2026-02-18 05:01:58 01622_constraints_where_optimization: [ OK ] 0.93 sec.
2026-02-18 05:01:58 02911_add_index_and_materialize_index: [ OK ] 0.58 sec.
2026-02-18 05:01:58 01585_use_index_for_global_in: [ OK ] 0.72 sec.
2026-02-18 05:01:58 01825_type_json_13: [ OK ] 5.66 sec.
2026-02-18 05:01:58 02916_csv_infer_numbers_from_strings: [ OK ] 0.63 sec.
2026-02-18 05:01:58 01796_Log_rwlock_ub: [ OK ] 0.68 sec.
2026-02-18 05:01:59 02351_Map_combinator_dist: [ OK ] 0.98 sec.
2026-02-18 05:01:59 00444_join_use_nulls: [ OK ] 0.73 sec.
2026-02-18 05:01:59 02424_pod_array_overflow: [ OK ] 0.63 sec.
2026-02-18 05:01:59 02286_convert_decimal_type: [ OK ] 0.67 sec.
2026-02-18 05:01:59 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.74 sec.
2026-02-18 05:01:59 00849_multiple_comma_join_2: [ OK ] 1.84 sec.
2026-02-18 05:02:00 03038_recursive_cte_postgres_4: [ OK ] 1.03 sec.
2026-02-18 05:02:00 02536_date_from_number_inference_fix: [ OK ] 0.73 sec.
2026-02-18 05:02:00 02025_subcolumns_compact_parts: [ OK ] 0.88 sec.
2026-02-18 05:02:00 01284_escape_sequences_php_mysql_style: [ OK ] 0.78 sec.
2026-02-18 05:02:00 02306_window_move_row_number_fix: [ OK ] 0.68 sec.
2026-02-18 05:02:01 00213_multiple_global_in: [ OK ] 0.73 sec.
2026-02-18 05:02:01 00357_to_string_complex_types: [ OK ] 0.78 sec.
2026-02-18 05:02:01 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 1.03 sec.
2026-02-18 05:02:02 03032_numbers_zeros: [ OK ] 0.87 sec.
2026-02-18 05:02:02 01430_modify_sample_by_zookeeper_long: [ OK ] 1.98 sec.
2026-02-18 05:02:02 02472_segfault_expression_parser: [ OK ] 0.62 sec.
2026-02-18 05:02:02 00834_date_datetime_cmp: [ OK ] 0.78 sec.
2026-02-18 05:02:02 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.77 sec.
2026-02-18 05:02:03 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.78 sec.
2026-02-18 05:02:03 00258_materializing_tuples: [ OK ] 0.73 sec.
2026-02-18 05:02:04 02345_create_table_allow_trailing_comma: [ OK ] 0.93 sec.
2026-02-18 05:02:04 02844_table_function_url_filter_by_virtual_columns: [ OK ] 1.89 sec.
2026-02-18 05:02:04 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 1.13 sec.
2026-02-18 05:02:05 02163_operators: [ OK ] 0.68 sec.
2026-02-18 05:02:05 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.89 sec.
2026-02-18 05:02:06 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.94 sec.
2026-02-18 05:02:06 00974_primary_key_for_lowCardinality: [ OK ] 6.36 sec.
2026-02-18 05:02:06 00752_low_cardinality_array_result: [ OK ] 0.79 sec.
2026-02-18 05:02:07 01603_decimal_mult_float: [ OK ] 0.98 sec.
2026-02-18 05:02:08 00265_http_content_type_format_timezone: [ OK ] 2.44 sec.
2026-02-18 05:02:08 02894_ast_depth_check: [ OK ] 1.88 sec.
2026-02-18 05:02:09 02695_logical_optimizer_alias_bug: [ OK ] 0.93 sec.
2026-02-18 05:02:09 03003_functions_to_subcolumns_final: [ OK ] 0.93 sec.
2026-02-18 05:02:09 03036_parquet_arrow_nullable: [ OK ] 12.99 sec.
2026-02-18 05:02:09 01273_arrow_decimal: [ OK ] 5.50 sec.
2026-02-18 05:02:10 01666_gcd_ubsan: [ OK ] 0.98 sec.
2026-02-18 05:02:10 03230_subcolumns_mv: [ OK ] 0.83 sec.
2026-02-18 05:02:11 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 1.84 sec.
2026-02-18 05:02:11 02884_string_distance_function: [ OK ] 1.43 sec.
2026-02-18 05:02:11 00147_alter_nested_default: [ OK ] 1.08 sec.
2026-02-18 05:02:12 01440_big_int_shift: [ OK ] 0.76 sec.
2026-02-18 05:02:12 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 1.29 sec.
2026-02-18 05:02:12 00900_null_array_orc_load: [ OK ] 4.60 sec.
2026-02-18 05:02:13 02974_if_with_map: [ OK ] 0.98 sec.
2026-02-18 05:02:14 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 2.94 sec.
2026-02-18 05:02:14 02016_bit_shift_right_for_string_integer: [ OK ] 1.88 sec.
2026-02-18 05:02:14 01509_format_raw_blob: [ OK ] 4.00 sec.
2026-02-18 05:02:14 01076_range_reader_segfault: [ OK ] 0.68 sec.
2026-02-18 05:02:15 01780_column_sparse_distinct: [ OK ] 0.93 sec.
2026-02-18 05:02:15 02500_bson_read_object_id: [ OK ] 1.78 sec.
2026-02-18 05:02:16 00700_decimal_null: [ OK ] 1.23 sec.
2026-02-18 05:02:16 01927_query_views_log_current_database: [ OK ] 2.14 sec.
2026-02-18 05:02:17 01772_to_start_of_hour_align: [ OK ] 0.88 sec.
2026-02-18 05:02:17 02337_check_translate_qualified_names_matcher: [ OK ] 0.68 sec.
2026-02-18 05:02:17 02155_parse_date_lowcard_default_throw: [ OK ] 0.63 sec.
2026-02-18 05:02:18 02021_map_bloom_filter_index: [ OK ] 1.48 sec.
2026-02-18 05:02:18 02554_log_faminy_support_storage_policy: [ OK ] 0.92 sec.
2026-02-18 05:02:19 00266_read_overflow_mode: [ OK ] 0.73 sec.
2026-02-18 05:02:19 02811_csv_input_field_type_mismatch: [ OK ] 4.19 sec.
2026-02-18 05:02:19 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.83 sec.
2026-02-18 05:02:20 02783_parallel_replicas_trivial_count_optimization: [ OK ] 7.66 sec.
2026-02-18 05:02:20 02568_json_array_length: [ OK ] 0.78 sec.
2026-02-18 05:02:20 01421_array_nullable_element_nullable_index: [ OK ] 0.63 sec.
2026-02-18 05:02:20 02493_inconsistent_hex_and_binary_number: [ OK ] 4.94 sec.
2026-02-18 05:02:21 02050_clickhouse_local_parsing_exception: [ OK ] 1.33 sec.
2026-02-18 05:02:22 03033_create_as_copies_comment: [ OK ] 0.73 sec.
2026-02-18 05:02:22 03211_nested_json_merges: [ OK ] 63.95 sec.
2026-02-18 05:02:22 00356_analyze_aggregations_and_union_all: [ OK ] 0.53 sec.
2026-02-18 05:02:22 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 3.50 sec.
2026-02-18 05:02:23 02486_truncate_and_unexpected_parts: [ OK ] 3.03 sec.
2026-02-18 05:02:23 02943_variant_element: [ OK ] 0.78 sec.
2026-02-18 05:02:23 02566_analyzer_limit_settings_distributed: [ OK ] 0.83 sec.
2026-02-18 05:02:24 01825_type_json_1: [ OK ] 1.18 sec.
2026-02-18 05:02:24 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.93 sec.
2026-02-18 05:02:24 02122_4letter_words_stress_zookeeper: [ OK ] 22.78 sec.
2026-02-18 05:02:25 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 1.53 sec.
2026-02-18 05:02:25 00004_shard_format_ast_and_remote_table: [ OK ] 0.93 sec.
2026-02-18 05:02:26 01089_alter_settings_old_format: [ OK ] 0.98 sec.
2026-02-18 05:02:26 01135_default_and_alter_zookeeper: [ OK ] 0.93 sec.
2026-02-18 05:02:26 03214_backup_and_clear_old_temporary_directories: [ OK ] 6.35 sec.
2026-02-18 05:02:26 01490_nullable_string_to_enum: [ OK ] 0.68 sec.
2026-02-18 05:02:27 02911_analyzer_explain_estimate: [ OK ] 0.68 sec.
2026-02-18 05:02:27 03041_select_with_query_result: [ OK ] 0.98 sec.
2026-02-18 05:02:27 02995_index_9: [ SKIPPED ] 0.00 sec.
2026-02-18 05:02:27 Reason: not running for current build
2026-02-18 05:02:28 00059_shard_global_in: [ OK ] 0.68 sec.
2026-02-18 05:02:28 02015_async_inserts_1: [ OK ] 3.63 sec.
2026-02-18 05:02:28 02112_delayed_clickhouse_local: [ OK ] 1.43 sec.
2026-02-18 05:02:29 02933_compare_with_bool_as_string: [ OK ] 0.68 sec.
2026-02-18 05:02:29 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.93 sec.
2026-02-18 05:02:29 03222_json_squashing: [ OK ] 2.69 sec.
2026-02-18 05:02:29 02233_with_total_empty_chunk: [ OK ] 0.58 sec.
2026-02-18 05:02:30 02426_orc_bug: [ OK ] 1.63 sec.
2026-02-18 05:02:31 02315_readonly_create_function: [ OK ] 1.83 sec.
2026-02-18 05:02:31 03001_block_offset_column: [ OK ] 1.34 sec.
2026-02-18 05:02:32 01144_multiword_data_types: [ OK ] 0.52 sec.
2026-02-18 05:02:32 01621_summap_check_types: [ OK ] 0.73 sec.
2026-02-18 05:02:33 00676_group_by_in: [ OK ] 0.70 sec.
2026-02-18 05:02:33 02481_async_insert_dedup_token: [ OK ] 99.01 sec.
2026-02-18 05:02:33 01272_totals_and_filter_bug: [ OK ] 0.98 sec.
2026-02-18 05:02:33 01715_background_checker_blather_zookeeper_long: [ OK ] 11.12 sec.
2026-02-18 05:02:33 02999_analyzer_preimage_null: [ OK ] 0.73 sec.
2026-02-18 05:02:34 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.67 sec.
2026-02-18 05:02:34 02433_default_expression_operator_in: [ OK ] 0.83 sec.
2026-02-18 05:02:34 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.93 sec.
2026-02-18 05:02:34 00738_lock_for_inner_table: [ OK ] 5.14 sec.
2026-02-18 05:02:34 02487_create_index_normalize_functions: [ OK ] 0.78 sec.
2026-02-18 05:02:34 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec.
2026-02-18 05:02:34 Reason: not running for current build
2026-02-18 05:02:35 00980_crash_nullable_decimal: [ OK ] 0.73 sec.
2026-02-18 05:02:35 03199_has_lc_fixed_string: [ OK ] 0.68 sec.
2026-02-18 05:02:35 03010_sum_to_to_count_if_nullable: [ OK ] 0.88 sec.
2026-02-18 05:02:36 00003_reinterpret_as_string: [ OK ] 0.67 sec.
2026-02-18 05:02:36 03321_functions_to_subcolumns_skip_index: [ OK ] 0.78 sec.
2026-02-18 05:02:37 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.98 sec.
2026-02-18 05:02:37 01273_arrow_load: [ OK ] 4.19 sec.
2026-02-18 05:02:38 00199_ternary_operator_type_check: [ OK ] 1.38 sec.
2026-02-18 05:02:38 02842_mutations_replace_non_deterministic: [ OK ] 2.28 sec.
2026-02-18 05:02:39 01670_distributed_bytes_to_throw_insert: [ OK ] 0.78 sec.
2026-02-18 05:02:39 00952_input_function: [ OK ] 19.29 sec.
2026-02-18 05:02:40 02458_empty_hdfs_url: [ OK ] 0.74 sec.
2026-02-18 05:02:40 01122_totals_rollup_having_block_header: [ OK ] 0.73 sec.
2026-02-18 05:02:40 00909_arrayEnumerateUniq: [ OK ] 3.44 sec.
2026-02-18 05:02:41 01001_enums_in_in_section: [ OK ] 0.72 sec.
2026-02-18 05:02:41 00084_summing_merge_tree: [ OK ] 0.93 sec.
2026-02-18 05:02:41 03032_save_bad_json_escape_sequences: [ OK ] 0.73 sec.
2026-02-18 05:02:42 02732_rename_after_processing: [ OK ] 7.40 sec.
2026-02-18 05:02:42 02476_query_parameters_without_serialisation: [ OK ] 0.98 sec.
2026-02-18 05:02:43 02915_fpc_overflow: [ OK ] 1.88 sec.
2026-02-18 05:02:43 00439_fixed_string_filter: [ OK ] 0.73 sec.
2026-02-18 05:02:43 02677_grace_hash_limit_race: [ OK ] 0.93 sec.
2026-02-18 05:02:43 00917_multiple_joins_denny_crane: [ OK ] 0.78 sec.
2026-02-18 05:02:44 02014_map_different_keys: [ OK ] 0.93 sec.
2026-02-18 05:02:44 01011_group_uniq_array_memsan: [ OK ] 0.88 sec.
2026-02-18 05:02:44 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 6.14 sec.
2026-02-18 05:02:45 02311_system_zookeeper_insert: [ OK ] 1.29 sec.
2026-02-18 05:02:45 02223_h3_test_const_columns: [ OK ] 1.33 sec.
2026-02-18 05:02:45 03064_analyzer_named_subqueries: [ OK ] 0.68 sec.
2026-02-18 05:02:45 00758_array_reverse: [ OK ] 0.83 sec.
2026-02-18 05:02:46 02998_projection_after_attach_partition: [ OK ] 0.98 sec.
2026-02-18 05:02:46 01825_new_type_json_add_column: [ OK ] 1.18 sec.
2026-02-18 05:02:46 03273_dictionary_rbac: [ OK ] 5.89 sec.
2026-02-18 05:02:47 00753_quantile_format: [ OK ] 0.88 sec.
2026-02-18 05:02:48 02124_insert_deduplication_token_materialized_views: [ OK ] 3.19 sec.
2026-02-18 05:02:49 03068_analyzer_distributed_join: [ OK ] 1.14 sec.
2026-02-18 05:02:49 02192_comment_error: [ OK ] 3.28 sec.
2026-02-18 05:02:49 01502_bar_overflow: [ OK ] 0.88 sec.
2026-02-18 05:02:50 00848_join_use_nulls_segfault: [ OK ] 1.43 sec.
2026-02-18 05:02:50 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 1.13 sec.
2026-02-18 05:02:51 00559_filter_array_generic: [ OK ] 0.78 sec.
2026-02-18 05:02:51 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.73 sec.
2026-02-18 05:02:52 01116_asof_join_dolbyzerr: [ OK ] 0.83 sec.
2026-02-18 05:02:52 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 5.99 sec.
2026-02-18 05:02:52 00732_base64_functions: [ OK ] 0.98 sec.
2026-02-18 05:02:53 02535_ip_parser_not_whole: [ OK ] 0.67 sec.
2026-02-18 05:02:53 03167_base64_url_functions: [ OK ] 0.88 sec.
2026-02-18 05:02:53 01421_assert_in_in: [ OK ] 0.68 sec.
2026-02-18 05:02:54 01783_merge_engine_join_key_condition: [ OK ] 1.03 sec.
2026-02-18 05:02:54 02245_make_datetime64: [ OK ] 1.68 sec.
2026-02-18 05:02:54 01910_view_dictionary_check_refresh: [ OK ] 24.96 sec.
2026-02-18 05:02:54 00953_constraints_operations: [ OK ] 8.30 sec.
2026-02-18 05:02:55 00136_duplicate_order_by_elems: [ OK ] 0.78 sec.
2026-02-18 05:02:55 02596_build_set_and_remote: [ OK ] 1.33 sec.
2026-02-18 05:02:55 02491_part_log_has_table_uuid: [ OK ] 1.18 sec.
2026-02-18 05:02:55 02160_h3_hex_area_Km2: [ OK ] 0.68 sec.
2026-02-18 05:02:55 00205_scalar_subqueries: [ OK ] 0.98 sec.
2026-02-18 05:02:55 00506_union_distributed: [ OK ] 1.14 sec.
2026-02-18 05:02:56 01845_add_testcase_for_arrayElement: [ OK ] 0.73 sec.
2026-02-18 05:02:56 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.82 sec.
2026-02-18 05:02:56 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.63 sec.
2026-02-18 05:02:56 02707_analyzer_nested_lambdas_types: [ OK ] 0.72 sec.
2026-02-18 05:02:57 01460_mark_inclusion_search_crash: [ OK ] 0.73 sec.
2026-02-18 05:02:57 01399_http_request_headers: [ OK ] 1.49 sec.
2026-02-18 05:02:57 00697_in_subquery_shard: [ OK ] 1.23 sec.
2026-02-18 05:02:58 02482_value_block_parsing: [ OK ] 1.93 sec.
2026-02-18 05:02:58 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.73 sec.
2026-02-18 05:02:58 02473_multistep_split_prewhere: [ OK ] 34.27 sec.
2026-02-18 05:02:59 02560_analyzer_materialized_view: [ OK ] 0.93 sec.
2026-02-18 05:02:59 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.68 sec.
2026-02-18 05:03:00 01018_Distributed__shard_num: [ OK ] 1.73 sec.
2026-02-18 05:03:00 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.68 sec.
2026-02-18 05:03:00 02803_backup_tmp_files: [ OK ] 3.49 sec.
2026-02-18 05:03:00 01079_bad_alters_zookeeper_long: [ OK ] 11.67 sec.
2026-02-18 05:03:00 01287_max_execution_speed: [ OK ] 4.94 sec.
2026-02-18 05:03:01 02782_values_null_to_lc_nullable: [ OK ] 0.78 sec.
2026-02-18 05:03:01 01051_aggregate_function_crash: [ OK ] 0.67 sec.
2026-02-18 05:03:01 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 1.18 sec.
2026-02-18 05:03:01 00551_parse_or_null: [ OK ] 0.78 sec.
2026-02-18 05:03:02 01710_projection_drop_if_exists: [ OK ] 0.78 sec.
2026-02-18 05:03:02 02705_settings_check_changed_flag: [ OK ] 1.43 sec.
2026-02-18 05:03:02 01308_row_policy_and_trivial_count_query: [ OK ] 0.88 sec.
2026-02-18 05:03:02 00647_multiply_aggregation_state: [ OK ] 1.19 sec.
2026-02-18 05:03:02 02367_analyzer_table_alias_columns: [ OK ] 0.88 sec.
2026-02-18 05:03:02 01068_parens: [ OK ] 0.78 sec.
2026-02-18 05:03:02 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.73 sec.
2026-02-18 05:03:03 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.88 sec.
2026-02-18 05:03:03 01380_nullable_state: [ OK ] 1.43 sec.
2026-02-18 05:03:03 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 1.18 sec.
2026-02-18 05:03:04 02126_url_auth: [ OK ] 1.78 sec.
2026-02-18 05:03:04 00688_low_cardinality_serialization: [ OK ] 4.74 sec.
2026-02-18 05:03:04 03039_dynamic_summing_merge_tree: [ OK ] 29.23 sec.
2026-02-18 05:03:16 01039_row_policy_dcl: [ OK ] 13.06 sec.
2026-02-18 05:03:16 03215_varian_as_common_type_tuple_map: [ OK ] 12.56 sec.
2026-02-18 05:03:18 01083_cross_to_inner_with_in_bug: [ OK ] 13.78 sec.
2026-02-18 05:03:18 02341_global_join_cte: [ OK ] 14.42 sec.
2026-02-18 05:03:18 00464_array_element_out_of_range: [ OK ] 1.35 sec.
2026-02-18 05:03:18 00913_many_threads: [ OK ] 14.81 sec.
2026-02-18 05:03:18 02677_analyzer_compound_expressions: [ OK ] 1.84 sec.
2026-02-18 05:03:19 02881_system_detached_parts_modification_time: [ OK ] 0.88 sec.
2026-02-18 05:03:19 03200_memory_engine_alter_dynamic: [ OK ] 0.83 sec.
2026-02-18 05:03:19 02015_async_inserts_7: [ OK ] 14.72 sec.
2026-02-18 05:03:19 01781_token_extractor_buffer_overflow: [ OK ] 1.08 sec.
2026-02-18 05:03:20 02869_unicode_minus: [ OK ] 0.73 sec.
2026-02-18 05:03:20 02231_hierarchical_dictionaries_constant: [ OK ] 1.18 sec.
2026-02-18 05:03:20 01825_type_json_empty_string: [ OK ] 0.83 sec.
2026-02-18 05:03:20 00804_test_alter_compression_codecs: [ OK ] 22.49 sec.
2026-02-18 05:03:20 02004_max_hyperscan_regex_length: [ SKIPPED ] 0.00 sec.
2026-02-18 05:03:20 Reason: not running for current build
2026-02-18 05:03:20 03009_format_show_database: [ OK ] 1.84 sec.
2026-02-18 05:03:20 02500_analyzer_storage_view_crash_fix: [ OK ] 0.88 sec.
2026-02-18 05:03:20 01009_insert_select_data_loss: [ OK ] 0.68 sec.
2026-02-18 05:03:20 01096_block_serialized_state: [ OK ] 0.68 sec.
2026-02-18 05:03:20 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.93 sec.
2026-02-18 05:03:21 03240_insert_select_named_tuple: [ OK ] 0.93 sec.
2026-02-18 05:03:21 00800_low_cardinality_distributed_insert: [ OK ] 0.68 sec.
2026-02-18 05:03:21 01097_pre_limit: [ OK ] 0.68 sec.
2026-02-18 05:03:21 01671_aggregate_function_group_bitmap_data: [ OK ] 0.77 sec.
2026-02-18 05:03:21 02691_multiple_joins_backtick_identifiers: [ OK ] 0.88 sec.
2026-02-18 05:03:22 01949_heredoc_unfinished: [ OK ] 1.23 sec.
2026-02-18 05:03:22 00688_low_cardinality_syntax: [ OK ] 1.23 sec.
2026-02-18 05:03:22 01281_sum_nullable: [ OK ] 0.98 sec.
2026-02-18 05:03:22 00527_totals_having_nullable: [ OK ] 0.73 sec.
2026-02-18 05:03:22 01716_drop_rename_sign_column: [ OK ] 0.78 sec.
2026-02-18 05:03:23 03013_repeat_with_nonnative_integers: [ OK ] 0.68 sec.
2026-02-18 05:03:23 01926_union_all_schmak: [ OK ] 0.68 sec.
2026-02-18 05:03:23 02148_cast_type_parsing: [ OK ] 0.73 sec.
2026-02-18 05:03:24 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.67 sec.
2026-02-18 05:03:24 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.69 sec.
2026-02-18 05:03:26 00900_orc_arrow_parquet_maps: [ OK ] 22.99 sec.
2026-02-18 05:03:26 02813_seriesOutliersDetectTukey: [ OK ] 1.13 sec.
2026-02-18 05:03:26 01799_long_uniq_theta_sketch: [ OK ] 5.04 sec.
2026-02-18 05:03:28 02534_parquet_fixed_binary_array: [ OK ] 4.59 sec.
2026-02-18 05:03:28 01073_crlf_end_of_line: [ OK ] 0.73 sec.
2026-02-18 05:03:28 01176_mysql_client_interactive: [ OK ] 2.13 sec.
2026-02-18 05:03:29 01720_union_distinct_with_limit: [ OK ] 0.63 sec.
2026-02-18 05:03:30 01014_count_of_merges_metrics: [ OK ] 0.78 sec.
2026-02-18 05:03:31 02784_disable_async_with_dedup_correctly: [ OK ] 5.79 sec.
2026-02-18 05:03:32 03165_distinct_with_window_func_crash: [ OK ] 0.73 sec.
2026-02-18 05:03:33 02270_errors_in_files: [ OK ] 7.25 sec.
2026-02-18 05:03:34 01522_validate_alter_default: [ OK ] 0.78 sec.
2026-02-18 05:03:39 01825_type_json_15: [ OK ] 5.39 sec.
2026-02-18 05:03:40 01020_function_array_compact: [ OK ] 0.77 sec.
2026-02-18 05:03:40 00825_protobuf_format_persons: [ OK ] 16.93 sec.
2026-02-18 05:03:41 01825_new_type_json_insert_select: [ OK ] 1.28 sec.
2026-02-18 05:03:41 02661_read_from_archive_tar: [ OK ] 22.46 sec.
2026-02-18 05:03:42 02049_clickhouse_local_merge_tree: [ OK ] 1.73 sec.
2026-02-18 05:03:42 00411_long_accurate_number_comparison_int4: [ OK ] 9.86 sec.
2026-02-18 05:03:42 01585_fuzz_bits_with_bugfix: [ OK ] 0.68 sec.
2026-02-18 05:03:42 01721_join_implicit_cast_long: [ OK ] 12.43 sec.
2026-02-18 05:03:43 01001_rename_merge_race_condition: [ OK ] 14.13 sec.
2026-02-18 05:03:43 02676_trailing_commas: [ OK ] 0.73 sec.
2026-02-18 05:03:43 01032_cityHash64_for_UUID: [ OK ] 0.88 sec.
2026-02-18 05:03:43 01091_insert_with_default_json: [ OK ] 0.93 sec.
2026-02-18 05:03:43 01837_cast_to_array_from_empty_array: [ OK ] 0.69 sec.
2026-02-18 05:03:44 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.83 sec.
2026-02-18 05:03:44 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.93 sec.
2026-02-18 05:03:45 02669_alter_modify_to_nullable: [ OK ] 1.53 sec.
2026-02-18 05:03:45 02021_h3_is_res_classIII: [ OK ] 0.78 sec.
2026-02-18 05:03:45 00976_system_stop_ttl_merges: [ OK ] 1.98 sec.
2026-02-18 05:03:45 02705_grouping_keys_equal_keys: [ OK ] 0.78 sec.
2026-02-18 05:03:46 01576_alias_column_rewrite: [ OK ] 1.63 sec.
2026-02-18 05:03:46 02675_sparse_columns_clear_column: [ OK ] 0.98 sec.
2026-02-18 05:03:47 02597_column_delete_and_replication: [ OK ] 1.99 sec.
2026-02-18 05:03:47 02174_cte_scalar_cache_mv: [ OK ] 5.36 sec.
2026-02-18 05:03:47 02990_format_select_from_explain: [ OK ] 1.23 sec.
2026-02-18 05:03:47 02455_default_union_except_intersect: [ OK ] 1.29 sec.
2026-02-18 05:03:47 02496_row_binary_large_string_size: [ OK ] 1.73 sec.
2026-02-18 05:03:47 02724_mutliple_storage_join: [ OK ] 0.78 sec.
2026-02-18 05:03:48 00932_array_intersect_bug: [ OK ] 0.72 sec.
2026-02-18 05:03:48 01307_polygon_perimeter: [ OK ] 0.58 sec.
2026-02-18 05:03:48 00069_date_arithmetic: [ OK ] 0.83 sec.
2026-02-18 05:03:48 00672_arrayDistinct: [ OK ] 0.88 sec.
2026-02-18 05:03:48 01387_clear_column_default_depends: [ OK ] 0.93 sec.
2026-02-18 05:03:49 01136_multiple_sets: [ OK ] 0.73 sec.
2026-02-18 05:03:49 03208_buffer_over_distributed_type_mismatch: [ OK ] 1.48 sec.
2026-02-18 05:03:49 02874_toDaysSinceYearZero: [ OK ] 1.08 sec.
2026-02-18 05:03:49 02688_long_aggregate_function_names: [ OK ] 0.68 sec.
2026-02-18 05:03:50 01276_alter_rename_column_materialized_expr: [ OK ] 0.97 sec.
2026-02-18 05:03:50 03303_alias_inverse_order: [ OK ] 0.73 sec.
2026-02-18 05:03:50 00712_prewhere_with_alias_bug_2: [ OK ] 0.73 sec.
2026-02-18 05:03:50 01651_lc_insert_tiny_log_2: [ OK ] 7.41 sec.
2026-02-18 05:03:50 02932_parallel_replicas_fuzzer: [ OK ] 0.93 sec.
2026-02-18 05:03:50 01651_group_uniq_array_enum: [ OK ] 0.88 sec.
2026-02-18 05:03:51 01402_cast_nullable_string_to_enum: [ OK ] 0.87 sec.
2026-02-18 05:03:51 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.73 sec.
2026-02-18 05:03:51 01101_literal_column_clash: [ OK ] 0.94 sec.
2026-02-18 05:03:51 02296_nullable_arguments_in_array_filter: [ OK ] 0.68 sec.
2026-02-18 05:03:52 02515_tuple_lambda_parsing: [ OK ] 0.63 sec.
2026-02-18 05:03:52 02474_timeDiff_UTCTimestamp: [ OK ] 0.78 sec.
2026-02-18 05:03:52 01634_sum_map_nulls: [ OK ] 0.74 sec.
2026-02-18 05:03:52 01011_test_create_as_skip_indices: [ OK ] 0.68 sec.
2026-02-18 05:03:52 01787_arena_assert_column_nothing: [ OK ] 0.63 sec.
2026-02-18 05:03:53 01356_state_resample: [ OK ] 0.78 sec.
2026-02-18 05:03:53 02473_multistep_prewhere: [ OK ] 33.84 sec.
2026-02-18 05:03:53 02294_dictionaries_hierarchical_index: [ OK ] 1.08 sec.
2026-02-18 05:03:54 01542_collate_in_array: [ OK ] 0.98 sec.
2026-02-18 05:03:54 02154_bitmap_contains: [ OK ] 0.63 sec.
2026-02-18 05:03:54 01600_min_max_compress_block_size: [ OK ] 0.93 sec.
2026-02-18 05:03:55 01544_errorCodeToName: [ OK ] 0.73 sec.
2026-02-18 05:03:55 01691_parser_data_type_exponential: [ OK ] 7.15 sec.
2026-02-18 05:03:55 01470_explain: [ OK ] 0.63 sec.
2026-02-18 05:03:56 03215_varian_as_common_type_integers: [ OK ] 0.84 sec.
2026-02-18 05:03:56 00906_low_cardinality_rollup: [ OK ] 0.83 sec.
2026-02-18 05:03:57 00940_order_by_read_in_order: [ OK ] 1.53 sec.
2026-02-18 05:03:57 03262_column_sizes_with_dynamic_structure: [ OK ] 2.94 sec.
2026-02-18 05:03:57 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.73 sec.
2026-02-18 05:03:57 02921_file_engine_size_virtual_column: [ OK ] 2.54 sec.
2026-02-18 05:03:58 01021_only_tuple_columns: [ OK ] 1.13 sec.
2026-02-18 05:03:58 01891_partition_by_uuid: [ OK ] 0.83 sec.
2026-02-18 05:03:58 02845_arrayShiftRotate: [ OK ] 1.84 sec.
2026-02-18 05:03:59 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.78 sec.
2026-02-18 05:03:59 03060_analyzer_regular_view_alias: [ OK ] 0.62 sec.
2026-02-18 05:04:00 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.73 sec.
2026-02-18 05:04:00 03013_ignore_drop_queries_probability: [ OK ] 0.88 sec.
2026-02-18 05:04:00 02543_alter_update_rename_stuck: [ OK ] 9.56 sec.
2026-02-18 05:04:00 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec.
2026-02-18 05:04:00 Reason: not running for current build
2026-02-18 05:04:01 02008_test_union_distinct_in_subquery: [ OK ] 0.88 sec.
2026-02-18 05:04:02 02724_function_in_left_table_clause_asof_join: [ OK ] 0.88 sec.
2026-02-18 05:04:02 02479_mysql_connect_to_self: [ OK ] 1.63 sec.
2026-02-18 05:04:02 02228_merge_tree_insert_memory_usage: [ OK ] 3.64 sec.
2026-02-18 05:04:02 02932_idna: [ OK ] 2.13 sec.
2026-02-18 05:04:02 02246_is_secure_query_log: [ OK ] 10.01 sec.
2026-02-18 05:04:02 01604_explain_ast_of_nonselect_query: [ OK ] 0.68 sec.
2026-02-18 05:04:03 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.98 sec.
2026-02-18 05:04:03 01256_misspell_layout_name_podshumok: [ OK ] 0.73 sec.
2026-02-18 05:04:03 02900_buffer_table_alter_race: [ OK ] 12.72 sec.
2026-02-18 05:04:03 03008_deduplication_wrong_mv: [ OK ] 0.83 sec.
2026-02-18 05:04:03 00757_enum_defaults_const: [ OK ] 0.63 sec.
2026-02-18 05:04:04 00619_extract: [ OK ] 0.84 sec.
2026-02-18 05:04:04 00835_if_generic_case: [ OK ] 1.08 sec.
2026-02-18 05:04:04 01322_cast_keep_nullable: [ OK ] 0.78 sec.
2026-02-18 05:04:04 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.88 sec.
2026-02-18 05:04:04 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.68 sec.
2026-02-18 05:04:04 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.68 sec.
2026-02-18 05:04:05 01551_mergetree_read_in_order_spread: [ OK ] 0.83 sec.
2026-02-18 05:04:06 01746_long_zlib_http_compression_json_format: [ OK ] 1.74 sec.
2026-02-18 05:04:06 00135_duplicate_group_by_keys_segfault: [ OK ] 0.29 sec.
2026-02-18 05:04:07 01508_format_regexp_raw: [ OK ] 3.44 sec.
2026-02-18 05:04:07 01595_countMatches: [ OK ] 1.13 sec.
2026-02-18 05:04:08 01070_alter_with_ttl: [ OK ] 0.73 sec.
2026-02-18 05:04:08 00976_max_execution_speed: [ OK ] 3.79 sec.
2026-02-18 05:04:08 01273_arrow_nullable_arrays_load: [ OK ] 5.90 sec.
2026-02-18 05:04:09 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 1.80 sec.
2026-02-18 05:04:09 01621_bar_nan_arguments: [ OK ] 0.88 sec.
2026-02-18 05:04:09 02024_join_on_or_long: [ OK ] 3.86 sec.
2026-02-18 05:04:09 00506_shard_global_in_union: [ OK ] 1.23 sec.
2026-02-18 05:04:09 03034_ddls_and_merges_with_unusual_maps: [ OK ] 1.08 sec.
2026-02-18 05:04:10 00668_compare_arrays_silviucpp: [ OK ] 0.89 sec.
2026-02-18 05:04:10 01497_extract_all_groups_empty_match: [ OK ] 0.73 sec.
2026-02-18 05:04:10 02461_mullable_pk_monotonicity_bug: [ OK ] 1.43 sec.
2026-02-18 05:04:12 01284_port: [ OK ] 1.38 sec.
2026-02-18 05:04:13 02553_new_type_json_attach_partition: [ OK ] 0.99 sec.
2026-02-18 05:04:13 02915_input_table_function_in_subquery: [ OK ] 2.63 sec.
2026-02-18 05:04:14 01106_const_fixed_string_like: [ OK ] 1.26 sec.
2026-02-18 05:04:15 02122_parallel_formatting_Values: [ OK ] 5.14 sec.
2026-02-18 05:04:15 01461_query_start_time_microseconds: [ OK ] 1.53 sec.
2026-02-18 05:04:16 01410_nullable_key_and_index_negate_cond: [ OK ] 1.08 sec.
2026-02-18 05:04:16 01774_tuple_null_in: [ OK ] 0.69 sec.
2026-02-18 05:04:17 00540_bad_data_types: [ OK ] 12.93 sec.
2026-02-18 05:04:17 00746_compile_non_deterministic_function: [ OK ] 7.01 sec.
2026-02-18 05:04:17 01942_untuple_transformers_msan: [ OK ] 0.72 sec.
2026-02-18 05:04:18 00805_round_down: [ OK ] 1.34 sec.
2026-02-18 05:04:19 01283_strict_resize_bug: [ OK ] 2.03 sec.
2026-02-18 05:04:19 03038_ambiguous_column: [ OK ] 0.94 sec.
2026-02-18 05:04:20 02902_topKGeneric_deserialization_memory: [ OK ] 0.68 sec.
2026-02-18 05:04:21 01515_logtrace_function: [ OK ] 2.08 sec.
2026-02-18 05:04:21 01925_json_as_string_data_in_square_brackets: [ OK ] 0.94 sec.
2026-02-18 05:04:22 02734_optimize_group_by: [ OK ] 0.73 sec.
2026-02-18 05:04:22 02875_fix_column_decimal_serialization: [ OK ] 0.95 sec.
2026-02-18 05:04:23 02559_add_parts: [ OK ] 0.83 sec.
2026-02-18 05:04:24 02456_test_zero_copy_mutation: [ OK ] 0.95 sec.
2026-02-18 05:04:24 01518_select_in_null: [ OK ] 1.93 sec.
2026-02-18 05:04:25 02235_check_table_sparse_serialization: [ OK ] 0.84 sec.
2026-02-18 05:04:26 01641_memory_tracking_insert_optimize: [ OK ] 1.94 sec.
2026-02-18 05:04:26 02790_async_queries_in_query_log: [ OK ] 16.78 sec.
2026-02-18 05:04:26 02006_client_test_hint_error_name: [ OK ] 0.68 sec.
2026-02-18 05:04:26 02722_matcher_join_use_nulls: [ OK ] 1.73 sec.
2026-02-18 05:04:27 01088_array_slice_of_aggregate_functions: [ OK ] 0.84 sec.
2026-02-18 05:04:27 02019_multiple_weird_with_fill: [ OK ] 0.68 sec.
2026-02-18 05:04:28 01825_type_json_2: [ OK ] 1.23 sec.
2026-02-18 05:04:28 00616_final_single_part: [ OK ] 1.18 sec.
2026-02-18 05:04:28 02444_async_broken_outdated_part_loading: [ OK ] 13.35 sec.
2026-02-18 05:04:28 00209_insert_select_extremes: [ OK ] 0.88 sec.
2026-02-18 05:04:29 01458_is_decimal_overflow: [ OK ] 1.00 sec.
2026-02-18 05:04:29 02002_sampling_and_unknown_column_bug: [ OK ] 1.03 sec.
2026-02-18 05:04:29 01259_dictionary_custom_settings_ddl: [ OK ] 1.03 sec.
2026-02-18 05:04:30 03002_map_array_functions_with_low_cardinality: [ OK ] 0.83 sec.
2026-02-18 05:04:30 02526_kv_engine_different_filter_type: [ OK ] 1.03 sec.
2026-02-18 05:04:30 02985_if_over_big_int_decimal: [ OK ] 1.04 sec.
2026-02-18 05:04:30 01852_hints_enum_name: [ OK ] 2.04 sec.
2026-02-18 05:04:31 00172_constexprs_in_set: [ OK ] 0.88 sec.
2026-02-18 05:04:31 00409_shard_limit_by: [ OK ] 1.30 sec.
2026-02-18 05:04:31 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.78 sec.
2026-02-18 05:04:31 00752_low_cardinality_left_array_join: [ OK ] 1.03 sec.
2026-02-18 05:04:32 02868_select_support_from_keywords: [ OK ] 0.52 sec.
2026-02-18 05:04:32 00204_extract_url_parameter: [ OK ] 0.75 sec.
2026-02-18 05:04:32 01388_clear_all_columns: [ OK ] 1.28 sec.
2026-02-18 05:04:33 02880_indexHint__partition_id: [ OK ] 0.93 sec.
2026-02-18 05:04:33 00996_neighbor: [ OK ] 1.02 sec.
2026-02-18 05:04:33 02416_json_tuple_to_array_schema_inference: [ OK ] 0.80 sec.
2026-02-18 05:04:33 00358_from_string_complex_types: [ OK ] 0.73 sec.
2026-02-18 05:04:33 00626_replace_partition_from_table_zookeeper: [ OK ] 71.21 sec.
2026-02-18 05:04:33 01658_values_ubsan: [ OK ] 0.85 sec.
2026-02-18 05:04:34 02392_every_setting_must_have_documentation: [ OK ] 0.77 sec.
2026-02-18 05:04:34 00969_roundDuration: [ OK ] 0.73 sec.
2026-02-18 05:04:34 00098_6_union_all: [ OK ] 0.68 sec.
2026-02-18 05:04:35 03041_analyzer_gigachad_join: [ OK ] 0.83 sec.
2026-02-18 05:04:35 02415_all_new_functions_must_be_documented: [ OK ] 0.84 sec.
2026-02-18 05:04:35 00052_all_left_join: [ OK ] 0.89 sec.
2026-02-18 05:04:36 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.76 sec.
2026-02-18 05:04:36 01353_nullable_tuple: [ OK ] 1.93 sec.
2026-02-18 05:04:36 02994_sanity_check_settings: [ OK ] 0.79 sec.
2026-02-18 05:04:37 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 22.56 sec.
2026-02-18 05:04:37 01719_join_timezone: [ OK ] 0.82 sec.
2026-02-18 05:04:37 00628_in_lambda_on_merge_table_bug: [ OK ] 1.08 sec.
2026-02-18 05:04:37 03162_dynamic_type_nested: [ OK ] 0.83 sec.
2026-02-18 05:04:38 00980_full_join_crash_fancyqlx: [ OK ] 1.04 sec.
2026-02-18 05:04:38 02302_clash_const_aggegate_join: [ OK ] 0.99 sec.
2026-02-18 05:04:39 03033_set_index_in: [ OK ] 2.24 sec.
2026-02-18 05:04:39 01682_gather_utils_ubsan: [ OK ] 0.68 sec.
2026-02-18 05:04:39 01442_date_time_with_params: [ OK ] 2.08 sec.
2026-02-18 05:04:40 00560_float_leading_plus_in_exponent: [ OK ] 0.78 sec.
2026-02-18 05:04:40 01273_arrow_arrays_load: [ OK ] 6.26 sec.
2026-02-18 05:04:40 01442_h3kring_range_check: [ OK ] 0.93 sec.
2026-02-18 05:04:40 01680_date_time_add_ubsan: [ OK ] 0.90 sec.
2026-02-18 05:04:41 03042_not_found_column_c1: [ OK ] 0.75 sec.
2026-02-18 05:04:41 00612_http_max_query_size_for_distributed: [ OK ] 0.88 sec.
2026-02-18 05:04:41 02681_undrop_query_uuid: [ OK ] 8.92 sec.
2026-02-18 05:04:41 01137_sample_final: [ OK ] 0.90 sec.
2026-02-18 05:04:41 02266_auto_add_nullable: [ OK ] 0.78 sec.
2026-02-18 05:04:41 02674_trivial_count_analyzer: [ OK ] 0.97 sec.
2026-02-18 05:04:41 00618_nullable_in: [ OK ] 0.84 sec.
2026-02-18 05:04:42 03036_schema_inference_cache_s3_archives: [ OK ] 0.98 sec.
2026-02-18 05:04:42 03165_order_by_duplicate: [ OK ] 0.85 sec.
2026-02-18 05:04:43 02416_rocksdb_delete_update: [ OK ] 1.18 sec.
2026-02-18 05:04:43 01037_zookeeper_check_table_empty_pk: [ OK ] 1.08 sec.
2026-02-18 05:04:43 02923_cte_equality_disjunction: [ OK ] 0.78 sec.
2026-02-18 05:04:43 02540_date_column_consistent_insert_behaviour: [ OK ] 1.69 sec.
2026-02-18 05:04:44 01891_not_like_partition_prune: [ OK ] 0.93 sec.
2026-02-18 05:04:44 02524_fuzz_and_fuss: [ OK ] 0.73 sec.
2026-02-18 05:04:44 02366_kql_native_interval_format: [ OK ] 0.82 sec.
2026-02-18 05:04:45 01700_mod_negative_type_promotion: [ OK ] 0.83 sec.
2026-02-18 05:04:46 01318_encrypt: [ OK ] 2.34 sec.
2026-02-18 05:04:47 02496_remove_redundant_sorting: [ OK ] 29.74 sec.
2026-02-18 05:04:48 01039_mergetree_exec_time: [ OK ] 1.73 sec.
2026-02-18 05:04:49 00988_constraints_replication_zookeeper_long: [ OK ] 1.13 sec.
2026-02-18 05:04:50 00395_nullable: [ OK ] 7.10 sec.
2026-02-18 05:04:50 01825_type_json_4: [ OK ] 7.49 sec.
2026-02-18 05:04:51 00513_fractional_time_zones: [ OK ] 0.62 sec.
2026-02-18 05:04:51 02267_jsonlines_ndjson_format: [ OK ] 0.80 sec.
2026-02-18 05:04:52 00825_protobuf_format_nested_in_nested: [ OK ] 4.95 sec.
2026-02-18 05:04:53 02861_filter_pushdown_const_bug: [ OK ] 0.88 sec.
2026-02-18 05:04:53 02010_lc_native: [ OK ] 3.91 sec.
2026-02-18 05:04:54 03014_window_view_crash: [ OK ] 0.78 sec.
2026-02-18 05:04:55 02907_preferred_optimize_projection_name: [ OK ] 14.10 sec.
2026-02-18 05:04:56 03144_fuzz_quoted_type_name: [ OK ] 0.83 sec.
2026-02-18 05:04:57 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.67 sec.
2026-02-18 05:04:57 01769_extended_range_2: [ OK ] 0.83 sec.
2026-02-18 05:04:58 02454_compressed_marks_in_compact_part: [ OK ] 0.88 sec.
2026-02-18 05:04:59 02458_insert_select_progress_tcp: [ OK ] 4.69 sec.
2026-02-18 05:04:59 02531_ipv4_arithmetic: [ OK ] 0.83 sec.
2026-02-18 05:05:00 02681_comparsion_tuple_elimination_ast: [ OK ] 0.88 sec.
2026-02-18 05:05:00 02570_fallback_from_async_insert: [ OK ] 6.96 sec.
2026-02-18 05:05:00 03096_largest_triangle_3b_crash: [ OK ] 0.73 sec.
2026-02-18 05:05:00 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.74 sec.
2026-02-18 05:05:01 00520_http_nullable: [ OK ] 1.48 sec.
2026-02-18 05:05:02 01085_simdjson_uint64: [ OK ] 0.78 sec.
2026-02-18 05:05:03 02562_native_tskv_default_for_omitted_fields: [ OK ] 11.67 sec.
2026-02-18 05:05:03 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.83 sec.
2026-02-18 05:05:04 02910_bad_logs_level_in_local: [ OK ] 0.73 sec.
2026-02-18 05:05:04 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 1.38 sec.
2026-02-18 05:05:04 03199_unbin_buffer_overflow: [ OK ] 18.86 sec.
2026-02-18 05:05:05 02814_create_index_uniq_noop: [ OK ] 0.77 sec.
2026-02-18 05:05:05 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 13.75 sec.
2026-02-18 05:05:06 01377_supertype_low_cardinality: [ OK ] 1.53 sec.
2026-02-18 05:05:07 00071_insert_fewer_columns: [ OK ] 0.83 sec.
2026-02-18 05:05:07 02943_order_by_all: [ OK ] 1.66 sec.
2026-02-18 05:05:08 01071_window_view_event_tumble_asc_join: [ OK ] 7.27 sec.
2026-02-18 05:05:08 01246_extractAllGroupsVertical: [ OK ] 1.19 sec.
2026-02-18 05:05:09 02313_cross_join_dup_col_names: [ OK ] 0.93 sec.
2026-02-18 05:05:09 01670_test_repeat_mysql_dialect: [ OK ] 0.68 sec.
2026-02-18 05:05:10 01514_empty_buffer_different_types: [ OK ] 0.77 sec.
2026-02-18 05:05:10 02567_native_type_conversions: [ OK ] 3.04 sec.
2026-02-18 05:05:10 03174_multiple_authentication_methods: [ OK ] 9.71 sec.
2026-02-18 05:05:10 00844_join_lightee2: [ OK ] 0.84 sec.
2026-02-18 05:05:11 02842_filesystem_cache_validate_path: [ OK ] 0.79 sec.
2026-02-18 05:05:11 00578_merge_table_sampling: [ OK ] 1.03 sec.
2026-02-18 05:05:12 01497_alias_on_default_array: [ OK ] 0.78 sec.
2026-02-18 05:05:12 02122_parallel_formatting_JSONCompactStrings: [ OK ] 8.00 sec.
2026-02-18 05:05:13 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.83 sec.
2026-02-18 05:05:14 02766_prql: [ OK ] 5.20 sec.
2026-02-18 05:05:15 02752_space_function: [ OK ] 1.54 sec.
2026-02-18 05:05:15 02725_any_join_single_row: [ OK ] 1.08 sec.
2026-02-18 05:05:15 01290_max_execution_speed_distributed: [ OK ] 3.70 sec.
2026-02-18 05:05:16 02833_tuple_concat: [ OK ] 0.94 sec.
2026-02-18 05:05:17 02135_local_create_db: [ OK ] 1.84 sec.
2026-02-18 05:05:17 02911_arrow_large_list: [ OK ] 1.58 sec.
2026-02-18 05:05:19 01923_ttl_with_modify_column: [ OK ] 1.29 sec.
2026-02-18 05:05:19 01015_empty_in_inner_right_join: [ OK ] 1.86 sec.
2026-02-18 05:05:20 01451_replicated_detach_drop_and_quorum_long: [ OK ] 1.31 sec.
2026-02-18 05:05:24 02366_kql_func_dynamic: [ OK ] 3.56 sec.
2026-02-18 05:05:24 00909_kill_not_initialized_query: [ OK ] 13.20 sec.
2026-02-18 05:05:25 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 1.49 sec.
2026-02-18 05:05:26 03165_parseReadableSize: [ OK ] 1.89 sec.
2026-02-18 05:05:28 00368_format_option_collision: [ OK ] 2.50 sec.
2026-02-18 05:05:29 00667_compare_arrays_of_different_types: [ OK ] 0.78 sec.
2026-02-18 05:05:30 02421_truncate_isolation_with_mutations: [ OK ] 51.94 sec.
2026-02-18 05:05:30 02789_reading_from_s3_with_connection_pool: [ OK ] 11.12 sec.
2026-02-18 05:05:31 02713_ip4_uint_compare: [ OK ] 0.84 sec.
2026-02-18 05:05:31 02751_protobuf_ipv6: [ OK ] 2.39 sec.
2026-02-18 05:05:32 00808_not_optimize_predicate: [ OK ] 1.40 sec.
2026-02-18 05:05:32 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 1.45 sec.
2026-02-18 05:05:32 01134_max_rows_to_group_by: [ OK ] 0.99 sec.
2026-02-18 05:05:33 00038_totals_limit: [ OK ] 0.84 sec.
2026-02-18 05:05:33 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 1.04 sec.
2026-02-18 05:05:34 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 1.48 sec.
2026-02-18 05:05:34 02967_analyzer_fuzz: [ OK ] 0.95 sec.
2026-02-18 05:05:35 00950_default_prewhere: [ OK ] 1.08 sec.
2026-02-18 05:05:37 03040_dynamic_type_alters_1_memory: [ OK ] 1.60 sec.
2026-02-18 05:05:37 02935_http_content_type_with_http_headers_progress: [ OK ] 21.17 sec.
2026-02-18 05:05:37 01656_sequence_next_node_long: [ OK ] 11.55 sec.
2026-02-18 05:05:37 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 3.86 sec.
2026-02-18 05:05:37 01471_with_format: [ OK ] 0.83 sec.
2026-02-18 05:05:38 02354_with_statement_non_exist_column: [ OK ] 0.88 sec.
2026-02-18 05:05:38 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec.
2026-02-18 05:05:38 Reason: not running for current build
2026-02-18 05:05:39 03215_multilinestring_geometry: [ OK ] 1.18 sec.
2026-02-18 05:05:39 03041_recursive_cte_postgres_7: [ OK ] 1.53 sec.
2026-02-18 05:05:40 02832_transform_fixed_string_no_default: [ OK ] 0.84 sec.
2026-02-18 05:05:40 02456_alter-nullable-column-bag-2: [ OK ] 1.24 sec.
2026-02-18 05:05:40 01798_uniq_theta_sketch: [ OK ] 2.45 sec.
2026-02-18 05:05:41 01913_names_of_tuple_literal: [ OK ] 0.73 sec.
2026-02-18 05:05:41 00394_new_nested_column_keeps_offsets: [ OK ] 0.89 sec.
2026-02-18 05:05:41 02220_array_join_format: [ OK ] 0.83 sec.
2026-02-18 05:05:42 02476_fix_cast_parser_bug: [ OK ] 0.78 sec.
2026-02-18 05:05:42 02354_window_expression_with_aggregation_expression: [ OK ] 0.93 sec.
2026-02-18 05:05:42 00720_with_cube: [ OK ] 1.08 sec.
2026-02-18 05:05:42 01528_clickhouse_local_prepare_parts: [ OK ] 8.37 sec.
2026-02-18 05:05:43 01326_hostname_alias: [ OK ] 0.83 sec.
2026-02-18 05:05:43 01532_primary_key_without_order_by_zookeeper: [ OK ] 1.48 sec.
2026-02-18 05:05:43 03126_column_not_under_group_by: [ OK ] 0.74 sec.
2026-02-18 05:05:44 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 1.74 sec.
2026-02-18 05:05:44 00997_extract_all_crash_6627: [ OK ] 0.73 sec.
2026-02-18 05:05:44 02800_transform_alter: [ OK ] 0.99 sec.
2026-02-18 05:05:45 01096_zeros: [ OK ] 0.84 sec.
2026-02-18 05:05:45 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.50 sec.
2026-02-18 05:05:46 00535_parse_float_scientific: [ OK ] 0.72 sec.
2026-02-18 05:05:46 00066_group_by_in: [ OK ] 0.72 sec.
2026-02-18 05:05:47 02517_uuid_parsing: [ OK ] 0.88 sec.
2026-02-18 05:05:47 01797_StripeLog_rwlock_ub: [ OK ] 0.93 sec.
2026-02-18 05:05:47 01559_misplaced_codec_diagnostics: [ OK ] 0.73 sec.
2026-02-18 05:05:48 02012_sha512_fixedstring: [ OK ] 0.88 sec.
2026-02-18 05:05:49 02316_const_string_intersact: [ OK ] 0.73 sec.
2026-02-18 05:05:50 01080_window_view_inner_table_memory_hop: [ OK ] 5.70 sec.
2026-02-18 05:05:50 02244_make_datetime: [ OK ] 1.38 sec.
2026-02-18 05:05:52 02122_parallel_formatting_CustomSeparated: [ OK ] 4.73 sec.
2026-02-18 05:05:52 02813_series_period_detect: [ OK ] 1.05 sec.
2026-02-18 05:05:52 00048_a_stored_aggregates_merge: [ OK ] 0.88 sec.
2026-02-18 05:05:53 02841_parallel_final_wrong_columns_order: [ OK ] 2.74 sec.
2026-02-18 05:05:53 03251_unaligned_window_function_state: [ OK ] 0.73 sec.
2026-02-18 05:05:54 01710_projection_group_by_order_by: [ OK ] 0.64 sec.
2026-02-18 05:05:55 02454_set_parameters_formatting: [ OK ] 1.53 sec.
2026-02-18 05:05:55 00944_ml_test: [ OK ] 0.88 sec.
2026-02-18 05:05:55 02941_variant_type_4: [ OK ] 44.58 sec.
2026-02-18 05:05:55 01044_h3_edge_angle: [ OK ] 0.73 sec.
2026-02-18 05:05:55 03147_asof_join_ddb_missing: [ OK ] 3.79 sec.
2026-02-18 05:05:56 01458_named_tuple_millin: [ OK ] 0.54 sec.
2026-02-18 05:05:56 02370_analyzer_in_function: [ OK ] 1.19 sec.
2026-02-18 05:05:56 02862_sorted_distinct_sparse_fix: [ OK ] 0.88 sec.
2026-02-18 05:05:57 00341_squashing_insert_select2: [ OK ] 1.03 sec.
2026-02-18 05:05:57 01053_if_chain_check: [ OK ] 0.93 sec.
2026-02-18 05:05:57 01079_bit_operations_using_bitset: [ OK ] 0.93 sec.
2026-02-18 05:05:58 02553_type_object_analyzer: [ OK ] 0.83 sec.
2026-02-18 05:05:58 00969_columns_clause: [ OK ] 0.85 sec.
2026-02-18 05:05:58 02003_compress_bz2: [ OK ] 2.78 sec.
2026-02-18 05:05:59 02997_projections_formatting: [ OK ] 0.54 sec.
2026-02-18 05:05:59 00857_global_joinsavel_table_alias: [ OK ] 1.24 sec.
2026-02-18 05:05:59 02312_parquet_orc_arrow_names_tuples: [ OK ] 1.12 sec.
2026-02-18 05:06:00 00712_nan_comparison: [ OK ] 1.14 sec.
2026-02-18 05:06:02 00800_low_cardinality_merge_join: [ OK ] 2.60 sec.
2026-02-18 05:06:03 01774_case_sensitive_connection_id: [ OK ] 0.83 sec.
2026-02-18 05:06:04 02962_indexHint_rpn_construction: [ OK ] 0.78 sec.
2026-02-18 05:06:04 00700_decimal_arithm: [ OK ] 3.99 sec.
2026-02-18 05:06:05 00558_parse_floats: [ OK ] 0.87 sec.
2026-02-18 05:06:07 03222_datetime64_small_value_const: [ OK ] 1.64 sec.
2026-02-18 05:06:07 01632_max_partitions_to_read: [ OK ] 0.88 sec.
2026-02-18 05:06:08 02374_in_tuple_index: [ OK ] 0.94 sec.
2026-02-18 05:06:09 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.69 sec.
2026-02-18 05:06:10 02811_primary_key_in_columns: [ OK ] 1.19 sec.
2026-02-18 05:06:11 01851_hedged_connections_external_tables: [ OK ] 0.73 sec.
2026-02-18 05:06:12 01518_filtering_aliased_materialized_column: [ OK ] 0.93 sec.
2026-02-18 05:06:12 02130_parse_quoted_null: [ OK ] 13.15 sec.
2026-02-18 05:06:13 02560_count_digits: [ OK ] 0.78 sec.
2026-02-18 05:06:13 00900_long_parquet: [ OK ] 68.26 sec.
2026-02-18 05:06:14 03208_numbers_total_rows_approx: [ OK ] 0.73 sec.
2026-02-18 05:06:14 02177_merge_optimize_aggregation_in_order: [ OK ] 0.85 sec.
2026-02-18 05:06:14 03140_client_subsequent_external_tables: [ OK ] 1.98 sec.
2026-02-18 05:06:15 02705_projection_and_ast_optimizations_bug: [ OK ] 0.80 sec.
2026-02-18 05:06:15 02111_global_context_temporary_tables: [ OK ] 0.83 sec.
2026-02-18 05:06:16 00405_output_format_pretty_color: [ OK ] 1.28 sec.
2026-02-18 05:06:17 01925_date_date_time_comparison: [ OK ] 0.83 sec.
2026-02-18 05:06:17 00411_merge_tree_where_const_in_set: [ OK ] 0.88 sec.
2026-02-18 05:06:19 00872_t64_bit_codec: [ OK ] 3.95 sec.
2026-02-18 05:06:20 00908_bloom_filter_index: [ OK ] 42.33 sec.
2026-02-18 05:06:20 02535_analyzer_limit_offset: [ OK ] 0.74 sec.
2026-02-18 05:06:20 01433_hex_float: [ OK ] 0.69 sec.
2026-02-18 05:06:21 00185_array_literals: [ OK ] 0.98 sec.
2026-02-18 05:06:22 02875_parallel_replicas_cluster_all_replicas: [ OK ] 1.58 sec.
2026-02-18 05:06:22 02895_npy_format: [ OK ] 18.41 sec.
2026-02-18 05:06:22 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.84 sec.
2026-02-18 05:06:23 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.84 sec.
2026-02-18 05:06:23 01761_cast_to_enum_nullable: [ OK ] 0.73 sec.
2026-02-18 05:06:23 03290_final_collapsing: [ OK ] 1.08 sec.
2026-02-18 05:06:24 01451_replicated_detach_drop_part_long: [ OK ] 1.34 sec.
2026-02-18 05:06:25 02538_alter_rename_sequence: [ OK ] 1.33 sec.
2026-02-18 05:06:25 01831_max_streams: [ OK ] 0.83 sec.
2026-02-18 05:06:25 02679_query_parameters_dangling_pointer: [ OK ] 0.78 sec.
2026-02-18 05:06:26 01825_type_json_field: [ OK ] 0.78 sec.
2026-02-18 05:06:26 01889_check_row_policy_defined_using_user_function: [ OK ] 12.33 sec.
2026-02-18 05:06:27 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.88 sec.
2026-02-18 05:06:27 00348_tuples: [ OK ] 1.08 sec.
2026-02-18 05:06:28 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.78 sec.
2026-02-18 05:06:28 00520_tuple_values_interpreter: [ OK ] 0.73 sec.
2026-02-18 05:06:28 01060_window_view_event_tumble_to_asc: [ OK ] 5.74 sec.
2026-02-18 05:06:29 00608_uniq_array: [ OK ] 0.73 sec.
2026-02-18 05:06:29 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.94 sec.
2026-02-18 05:06:30 00234_disjunctive_equality_chains_optimization: [ OK ] 0.66 sec.
2026-02-18 05:06:31 02975_intdiv_with_decimal: [ OK ] 1.13 sec.
2026-02-18 05:06:32 00732_decimal_summing_merge_tree: [ OK ] 0.88 sec.
2026-02-18 05:06:33 02813_array_agg: [ OK ] 0.89 sec.
2026-02-18 05:06:34 01882_scalar_subquery_exception: [ OK ] 0.88 sec.
2026-02-18 05:06:34 02287_ephemeral_format_crash: [ OK ] 0.79 sec.
2026-02-18 05:06:35 02346_fulltext_index_bug47393: [ OK ] 0.98 sec.
2026-02-18 05:06:36 02372_analyzer_join: [ OK ] 7.32 sec.
2026-02-18 05:06:36 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.63 sec.
2026-02-18 05:06:37 00098_f_union_all: [ OK ] 0.83 sec.
2026-02-18 05:06:37 02354_vector_search_bugs: [ OK ] 1.43 sec.
2026-02-18 05:06:38 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 1.28 sec.
2026-02-18 05:06:39 02274_full_sort_join_nodistinct: [ OK ] 10.56 sec.
2026-02-18 05:06:40 01049_window_view_window_functions: [ OK ] 1.73 sec.
2026-02-18 05:06:40 02359_send_logs_source_regexp: [ OK ] 2.66 sec.
2026-02-18 05:06:40 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.89 sec.
2026-02-18 05:06:41 00715_bounding_ratio_merge_empty: [ OK ] 0.88 sec.
2026-02-18 05:06:42 03456_match_index_prefix_extraction: [ OK ] 1.79 sec.
2026-02-18 05:06:43 02021_exponential_sum_shard: [ OK ] 2.01 sec.
2026-02-18 05:06:43 01825_type_json_5: [ OK ] 1.23 sec.
2026-02-18 05:06:44 00726_materialized_view_concurrent: [ OK ] 0.88 sec.
2026-02-18 05:06:44 01603_read_with_backoff_bug: [ OK ] 47.27 sec.
2026-02-18 05:06:44 01312_case_insensitive_regexp: [ OK ] 0.78 sec.
2026-02-18 05:06:45 01914_ubsan_quantile_timing: [ OK ] 0.83 sec.
2026-02-18 05:06:46 02699_polygons_sym_difference_total: [ OK ] 0.78 sec.
2026-02-18 05:06:46 01882_check_max_parts_to_merge_at_once: [ OK ] 5.60 sec.
2026-02-18 05:06:46 02240_get_type_serialization_streams: [ OK ] 0.78 sec.
2026-02-18 05:06:47 03271_decimal_monotonic_day_of_week: [ OK ] 0.73 sec.
2026-02-18 05:06:48 02290_client_insert_cancel: [ OK ] 1.99 sec.
2026-02-18 05:06:48 03046_column_in_block_array_join: [ OK ] 0.88 sec.
2026-02-18 05:06:48 02030_rocksdb_race_long: [ OK ] 22.66 sec.
2026-02-18 05:06:49 01892_setting_limit_offset_distributed: [ OK ] 0.88 sec.
2026-02-18 05:06:49 01945_system_warnings: [ OK ] 5.21 sec.
2026-02-18 05:06:50 00008_array_join: [ OK ] 0.63 sec.
2026-02-18 05:06:50 02809_has_token: [ OK ] 0.73 sec.
2026-02-18 05:06:51 02890_untuple_column_names: [ OK ] 1.04 sec.
2026-02-18 05:06:52 01686_rocksdb: [ OK ] 1.19 sec.
2026-02-18 05:06:52 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 4.34 sec.
2026-02-18 05:06:52 01034_move_partition_from_table_zookeeper: [ OK ] 70.27 sec.
2026-02-18 05:06:52 02995_bad_formatting_union_intersect: [ OK ] 0.68 sec.
2026-02-18 05:06:53 01802_toDateTime64_large_values: [ OK ] 0.78 sec.
2026-02-18 05:06:54 02800_clickhouse_local_default_settings: [ OK ] 1.48 sec.
2026-02-18 05:06:54 01277_fromUnixTimestamp64: [ OK ] 1.08 sec.
2026-02-18 05:06:55 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.78 sec.
2026-02-18 05:06:55 01273_arrow_dictionaries_load: [ OK ] 11.17 sec.
2026-02-18 05:06:55 02381_parse_array_of_tuples: [ OK ] 0.78 sec.
2026-02-18 05:06:55 02122_parallel_formatting_Markdown: [ OK ] 4.74 sec.
2026-02-18 05:06:55 01060_defaults_all_columns: [ OK ] 0.84 sec.
2026-02-18 05:06:56 02764_index_analysis_fix: [ OK ] 0.83 sec.
2026-02-18 05:06:56 01034_unknown_qualified_column_in_join: [ OK ] 0.78 sec.
2026-02-18 05:06:56 00477_parsing_data_types: [ OK ] 0.62 sec.
2026-02-18 05:06:56 02477_age_datetime64: [ OK ] 1.13 sec.
2026-02-18 05:06:56 02149_schema_inference: [ OK ] 39.02 sec.
2026-02-18 05:06:57 01271_show_privileges: [ OK ] 0.69 sec.
2026-02-18 05:06:57 00426_nulls_sorting: [ OK ] 0.98 sec.
2026-02-18 05:06:57 01925_map_populate_series_on_map: [ OK ] 1.13 sec.
2026-02-18 05:06:57 00227_quantiles_timing_arbitrary_order: [ OK ] 0.84 sec.
2026-02-18 05:06:57 03169_display_column_names_in_footer: [ OK ] 0.87 sec.
2026-02-18 05:06:58 02891_rename_table_without_keyword: [ OK ] 1.02 sec.
2026-02-18 05:06:58 02158_ztest: [ OK ] 0.82 sec.
2026-02-18 05:06:58 01655_agg_if_nullable: [ OK ] 0.69 sec.
2026-02-18 05:06:58 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.68 sec.
2026-02-18 05:06:58 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2026-02-18 05:06:58 Reason: not running for current build
2026-02-18 05:06:58 02276_full_sort_join_unsupported: [ OK ] 0.92 sec.
2026-02-18 05:06:59 01492_array_join_crash_13829: [ OK ] 0.63 sec.
2026-02-18 05:06:59 02503_join_switch_alias_fuzz: [ OK ] 0.73 sec.
2026-02-18 05:06:59 01921_test_progress_bar: [ OK ] 0.63 sec.
2026-02-18 05:06:59 01674_unicode_asan: [ OK ] 0.84 sec.
2026-02-18 05:06:59 01353_topk_enum: [ OK ] 0.80 sec.
2026-02-18 05:07:00 01801_s3_cluster_count: [ OK ] 0.82 sec.
2026-02-18 05:07:00 01095_tpch_like_smoke: [ OK ] 2.44 sec.
2026-02-18 05:07:00 00331_final_and_prewhere: [ OK ] 0.78 sec.
2026-02-18 05:07:00 00902_entropy: [ OK ] 1.03 sec.
2026-02-18 05:07:01 02226_low_cardinality_text_bloom_filter_index: [ OK ] 1.44 sec.
2026-02-18 05:07:01 02428_index_analysis_with_null_literal: [ OK ] 1.73 sec.
2026-02-18 05:07:01 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.78 sec.
2026-02-18 05:07:01 03032_scalars_create_as_select: [ OK ] 0.77 sec.
2026-02-18 05:07:02 03228_variant_permutation_issue: [ OK ] 1.08 sec.
2026-02-18 05:07:02 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.88 sec.
2026-02-18 05:07:02 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.93 sec.
2026-02-18 05:07:02 00938_test_retention_function: [ OK ] 0.83 sec.
2026-02-18 05:07:03 02875_final_invalid_read_ranges_bug: [ OK ] 0.98 sec.
2026-02-18 05:07:03 00809_add_days_segfault: [ OK ] 0.98 sec.
2026-02-18 05:07:04 00373_group_by_tuple: [ OK ] 0.68 sec.
2026-02-18 05:07:05 03156_default_multiquery_split: [ OK ] 2.63 sec.
2026-02-18 05:07:05 01010_partial_merge_join: [ OK ] 2.45 sec.
2026-02-18 05:07:06 00589_removal_unused_columns_aggregation: [ OK ] 1.08 sec.
2026-02-18 05:07:07 02122_parallel_formatting_JSON: [ OK ] 6.26 sec.
2026-02-18 05:07:07 01451_detach_drop_part: [ OK ] 1.18 sec.
2026-02-18 05:07:08 01851_s2_to_geo: [ OK ] 0.78 sec.
2026-02-18 05:07:08 02560_tuple_format: [ OK ] 1.48 sec.
2026-02-18 05:07:09 02731_nothing_deserialization: [ OK ] 0.68 sec.
2026-02-18 05:07:10 00712_prewhere_with_alias: [ OK ] 1.28 sec.
2026-02-18 05:07:10 02572_query_views_log_background_thread: [ OK ] 17.64 sec.
2026-02-18 05:07:10 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec.
2026-02-18 05:07:10 Reason: not running for current build
2026-02-18 05:07:10 02181_format_describe_query: [ OK ] 1.38 sec.
2026-02-18 05:07:11 01079_order_by_pk: [ OK ] 7.02 sec.
2026-02-18 05:07:12 00988_parallel_parts_removal: [ OK ] 6.36 sec.
2026-02-18 05:07:12 01526_param_uuid: [ OK ] 2.30 sec.
2026-02-18 05:07:12 02454_create_table_with_custom_disk: [ OK ] 0.89 sec.
2026-02-18 05:07:12 01927_query_views_log_matview_exceptions: [ OK ] 11.77 sec.
2026-02-18 05:07:13 00942_mv_rename_table: [ OK ] 0.89 sec.
2026-02-18 05:07:13 03031_tuple_elimination_analyzer: [ OK ] 0.88 sec.
2026-02-18 05:07:13 02572_max_intersections: [ OK ] 0.62 sec.
2026-02-18 05:07:14 01069_materialized_view_alter_target_table: [ OK ] 0.93 sec.
2026-02-18 05:07:14 02006_test_positional_arguments_on_cluster: [ OK ] 1.38 sec.
2026-02-18 05:07:14 01035_avg: [ OK ] 3.64 sec.
2026-02-18 05:07:14 02158_ztest_cmp: [ OK ] 3.84 sec.
2026-02-18 05:07:15 01825_type_json_mutations: [ OK ] 0.98 sec.
2026-02-18 05:07:15 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 1.25 sec.
2026-02-18 05:07:15 01825_new_type_json_bools: [ OK ] 0.78 sec.
2026-02-18 05:07:16 02875_parallel_replicas_remote: [ OK ] 1.69 sec.
2026-02-18 05:07:16 01282_system_parts_ttl_info: [ OK ] 0.80 sec.
2026-02-18 05:07:16 01690_quantilesTiming_ubsan: [ OK ] 0.78 sec.
2026-02-18 05:07:16 02840_grace_hash_join_structure_mismatch: [ OK ] 0.78 sec.
2026-02-18 05:07:16 00811_garbage: [ OK ] 0.88 sec.
2026-02-18 05:07:17 02885_create_distributed_table_without_as: [ OK ] 0.68 sec.
2026-02-18 05:07:19 02358_file_default_value: [ OK ] 2.63 sec.
2026-02-18 05:07:19 00431_if_nulls: [ OK ] 2.08 sec.
2026-02-18 05:07:20 02133_distributed_queries_formatting: [ OK ] 0.68 sec.
2026-02-18 05:07:21 00612_pk_in_tuple_perf: [ OK ] 6.56 sec.
2026-02-18 05:07:21 03145_asof_join_ddb_inequalities: [ OK ] 1.08 sec.
2026-02-18 05:07:21 02954_analyzer_fuzz_i57086: [ OK ] 0.63 sec.
2026-02-18 05:07:23 02243_make_date32: [ OK ] 1.79 sec.
2026-02-18 05:07:25 01343_min_bytes_to_use_mmap_io: [ OK ] 1.48 sec.
2026-02-18 05:07:26 00061_merge_tree_alter: [ OK ] 1.25 sec.
2026-02-18 05:07:26 03172_dynamic_binary_serialization: [ OK ] 37.82 sec.
2026-02-18 05:07:26 02561_temporary_table_grants: [ OK ] 11.78 sec.
2026-02-18 05:07:27 01430_fix_any_rewrite_aliases: [ OK ] 0.73 sec.
2026-02-18 05:07:27 02921_bit_hamming_distance_big_int: [ OK ] 0.73 sec.
2026-02-18 05:07:27 01414_freeze_does_not_prevent_alters: [ OK ] 1.04 sec.
2026-02-18 05:07:27 01280_unicode_whitespaces_lexer: [ OK ] 0.83 sec.
2026-02-18 05:07:28 00268_aliases_without_as_keyword: [ OK ] 0.73 sec.
2026-02-18 05:07:28 00981_topK_topKWeighted_long: [ OK ] 12.47 sec.
2026-02-18 05:07:28 02426_pod_array_overflow_3: [ OK ] 0.68 sec.
2026-02-18 05:07:29 01012_serialize_array_memory_usage: [ OK ] 0.97 sec.
2026-02-18 05:07:29 02354_parse_timedelta: [ OK ] 1.33 sec.
2026-02-18 05:07:29 03217_fliter_pushdown_no_keys: [ OK ] 0.88 sec.
2026-02-18 05:07:30 01448_json_compact_strings_each_row: [ OK ] 1.63 sec.
2026-02-18 05:07:31 02809_has_subsequence: [ OK ] 1.43 sec.
2026-02-18 05:07:33 01198_client_quota_key: [ OK ] 1.93 sec.
2026-02-18 05:07:33 00825_protobuf_format_skipped_column_in_nested: [ OK ] 4.59 sec.
2026-02-18 05:07:33 03208_uniq_with_empty_tuple: [ OK ] 0.83 sec.
2026-02-18 05:07:34 01020_function_char: [ OK ] 0.78 sec.
2026-02-18 05:07:35 02096_totals_global_in_bug: [ OK ] 0.68 sec.
2026-02-18 05:07:36 02324_compatibility_setting: [ OK ] 6.75 sec.
2026-02-18 05:07:36 02575_merge_prewhere_materialized: [ OK ] 0.83 sec.
2026-02-18 05:07:36 02047_log_family_complex_structs_data_file_dumps: [ OK ] 14.94 sec.
2026-02-18 05:07:37 02586_generate_random_structure: [ OK ] 1.03 sec.
2026-02-18 05:07:37 03039_dynamic_collapsing_merge_tree: [ OK ] 24.88 sec.
2026-02-18 05:07:37 02517_avro_bool_type: [ OK ] 1.58 sec.
2026-02-18 05:07:38 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.93 sec.
2026-02-18 05:07:38 02898_parallel_replicas_custom_key_final: [ OK ] 0.73 sec.
2026-02-18 05:07:38 00072_in_types: [ OK ] 0.73 sec.
2026-02-18 05:07:39 02114_bool_type: [ OK ] 0.72 sec.
2026-02-18 05:07:40 02174_cte_scalar_cache: [ OK ] 1.54 sec.
2026-02-18 05:07:40 02713_array_low_cardinality_string: [ OK ] 0.73 sec.
2026-02-18 05:07:41 00448_to_string_cut_to_zero: [ OK ] 0.78 sec.
2026-02-18 05:07:41 00307_format_xml: [ OK ] 0.78 sec.
2026-02-18 05:07:41 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 5.20 sec.
2026-02-18 05:07:42 01893_jit_aggregation_function_min_long: [ OK ] 2.38 sec.
2026-02-18 05:07:43 01119_optimize_trivial_insert_select: [ OK ] 1.23 sec.
2026-02-18 05:07:43 02661_read_from_archive_targz: [ OK ] 23.71 sec.
2026-02-18 05:07:43 02833_local_with_dialect: [ OK ] 2.03 sec.
2026-02-18 05:07:44 00834_limit_with_constant_expressions: [ OK ] 1.18 sec.
2026-02-18 05:07:44 02000_table_function_cluster_macros: [ OK ] 0.73 sec.
2026-02-18 05:07:44 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.88 sec.
2026-02-18 05:07:44 00443_optimize_final_vertical_merge: [ OK ] 14.43 sec.
2026-02-18 05:07:45 01171_mv_select_insert_isolation_long: [ OK ] 227.36 sec.
2026-02-18 05:07:45 03144_invalid_filter: [ OK ] 0.78 sec.
2026-02-18 05:07:45 03093_filter_push_down_crash: [ OK ] 0.78 sec.
2026-02-18 05:07:45 00829_bitmap_function: [ OK ] 2.44 sec.
2026-02-18 05:07:45 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 1.07 sec.
2026-02-18 05:07:46 00178_query_datetime64_index: [ OK ] 0.73 sec.
2026-02-18 05:07:46 03221_mutate_profile_events: [ OK ] 1.09 sec.
2026-02-18 05:07:46 02488_zero_copy_detached_parts_drop_table: [ OK ] 9.21 sec.
2026-02-18 05:07:47 01436_storage_merge_with_join_push_down: [ OK ] 0.83 sec.
2026-02-18 05:07:47 01666_date_lut_buffer_overflow: [ OK ] 0.83 sec.
2026-02-18 05:07:47 03161_decimal_binary_math: [ OK ] 1.73 sec.
2026-02-18 05:07:48 01664_decimal_ubsan: [ OK ] 0.58 sec.
2026-02-18 05:07:48 02591_bson_long_tuple: [ OK ] 0.68 sec.
2026-02-18 05:07:49 03153_dynamic_type_empty: [ OK ] 0.72 sec.
2026-02-18 05:07:49 01710_order_by_projections_incomplete: [ OK ] 0.77 sec.
2026-02-18 05:07:49 01822_short_circuit: [ OK ] 2.33 sec.
2026-02-18 05:07:49 00695_pretty_max_column_pad_width: [ OK ] 0.67 sec.
2026-02-18 05:07:49 01499_json_named_tuples: [ OK ] 0.78 sec.
2026-02-18 05:07:50 02025_having_filter_column: [ OK ] 0.73 sec.
2026-02-18 05:07:51 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 4.59 sec.
2026-02-18 05:07:52 03246_json_simd_rapid_parsers: [ OK ] 2.29 sec.
2026-02-18 05:07:53 02493_numeric_literals_with_underscores: [ OK ] 2.13 sec.
2026-02-18 05:07:53 01548_create_table_compound_column_format: [ OK ] 1.23 sec.
2026-02-18 05:07:53 01825_new_type_json_11: [ OK ] 8.16 sec.
2026-02-18 05:07:54 01818_move_partition_simple: [ OK ] 0.93 sec.
2026-02-18 05:07:54 02882_formatQuery: [ OK ] 1.18 sec.
2026-02-18 05:07:55 03205_json_cast_from_string: [ OK ] 0.89 sec.
2026-02-18 05:07:55 02122_join_group_by_timeout: [ OK ] 9.71 sec.
2026-02-18 05:07:55 02499_escaped_quote_schema_inference: [ OK ] 0.67 sec.
2026-02-18 05:07:55 01379_with_fill_several_columns: [ OK ] 0.73 sec.
2026-02-18 05:07:56 01121_remote_scalar_subquery: [ OK ] 0.73 sec.
2026-02-18 05:07:56 02520_group_array_last: [ OK ] 0.99 sec.
2026-02-18 05:07:56 03291_json_big_structure_deserialization: [ OK ] 23.05 sec.
2026-02-18 05:07:57 00851_http_insert_json_defaults: [ OK ] 3.54 sec.
2026-02-18 05:07:57 00804_test_custom_compression_codes_log_storages: [ OK ] 1.59 sec.
2026-02-18 05:07:57 01043_dictionary_attribute_properties_values: [ OK ] 0.93 sec.
2026-02-18 05:07:57 00730_unicode_terminal_format: [ OK ] 0.98 sec.
2026-02-18 05:07:58 02574_suspicious_low_cardinality_msan: [ OK ] 0.88 sec.
2026-02-18 05:07:58 02477_exists_fuzz_43478: [ OK ] 0.73 sec.
2026-02-18 05:07:58 00729_prewhere_array_join: [ OK ] 1.08 sec.
2026-02-18 05:07:59 00502_string_concat_with_array: [ OK ] 0.73 sec.
2026-02-18 05:07:59 02136_kill_scalar_queries: [ OK ] 2.43 sec.
2026-02-18 05:07:59 01623_byte_size_const: [ OK ] 0.73 sec.
2026-02-18 05:08:00 01041_h3_is_valid: [ OK ] 0.68 sec.
2026-02-18 05:08:00 01509_dictionary_preallocate: [ OK ] 1.98 sec.
2026-02-18 05:08:01 00197_if_fixed_string: [ OK ] 0.78 sec.
2026-02-18 05:08:01 02931_file_cluster: [ OK ] 1.88 sec.
2026-02-18 05:08:02 00652_replicated_mutations_default_database_zookeeper: [ OK ] 3.98 sec.
2026-02-18 05:08:03 02142_http_with_query_parameters: [ OK ] 1.28 sec.
2026-02-18 05:08:03 02477_analyzer_array_join_with_join: [ OK ] 1.73 sec.
2026-02-18 05:08:03 01097_cyclic_defaults: [ OK ] 1.18 sec.
2026-02-18 05:08:04 03008_uniq_exact_equal_ranges: [ OK ] 3.60 sec.
2026-02-18 05:08:04 00169_join_constant_keys: [ OK ] 0.78 sec.
2026-02-18 05:08:04 01532_clickhouse_local_tmp_folder: [ OK ] 1.53 sec.
2026-02-18 05:08:05 02176_dict_get_has_implicit_key_cast: [ OK ] 1.34 sec.
2026-02-18 05:08:05 01031_pmj_new_any_semi_join: [ OK ] 1.18 sec.
2026-02-18 05:08:05 03127_argMin_combinator_state: [ OK ] 0.93 sec.
2026-02-18 05:08:06 02113_untuple_func_alias: [ OK ] 0.78 sec.
2026-02-18 05:08:06 01062_pm_all_join_with_block_continuation: [ OK ] 16.79 sec.
2026-02-18 05:08:06 00441_nulls_in: [ OK ] 1.13 sec.
2026-02-18 05:08:07 02354_tuple_element_with_default: [ OK ] 0.88 sec.
2026-02-18 05:08:07 00514_interval_operators: [ OK ] 1.03 sec.
2026-02-18 05:08:08 02922_respect_nulls_Nullable: [ OK ] 1.23 sec.
2026-02-18 05:08:08 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.82 sec.
2026-02-18 05:08:08 00041_big_array_join: [ OK ] 0.98 sec.
2026-02-18 05:08:08 03010_view_prewhere_in: [ OK ] 0.78 sec.
2026-02-18 05:08:09 03131_rewrite_sum_if_nullable: [ OK ] 0.93 sec.
2026-02-18 05:08:10 01852_s2_get_neighbours: [ OK ] 0.68 sec.
2026-02-18 05:08:10 03196_max_intersections_arena_crash: [ OK ] 0.93 sec.
2026-02-18 05:08:10 02714_date_date32_in: [ OK ] 0.73 sec.
2026-02-18 05:08:10 03107_ill_formed_select_in_materialized_view: [ OK ] 0.73 sec.
2026-02-18 05:08:11 01038_array_of_unnamed_tuples: [ OK ] 0.78 sec.
2026-02-18 05:08:11 03152_analyzer_columns_list: [ OK ] 0.74 sec.
2026-02-18 05:08:12 01558_ttest_scipy: [ OK ] 3.69 sec.
2026-02-18 05:08:12 01631_date_overflow_as_partition_key: [ OK ] 0.73 sec.
2026-02-18 05:08:12 02366_kql_distinct: [ OK ] 0.77 sec.
2026-02-18 05:08:13 01640_distributed_async_insert_compression: [ OK ] 0.78 sec.
2026-02-18 05:08:13 01303_polygons_equals: [ OK ] 0.68 sec.
2026-02-18 05:08:14 01272_suspicious_codecs: [ OK ] 1.73 sec.
2026-02-18 05:08:14 03204_distributed_with_scalar_subquery: [ OK ] 0.89 sec.
2026-02-18 05:08:15 02353_compression_level: [ OK ] 19.14 sec.
2026-02-18 05:08:15 02429_combinators_in_array_reduce: [ OK ] 0.78 sec.
2026-02-18 05:08:15 01668_avg_weighted_ubsan: [ OK ] 0.68 sec.
2026-02-18 05:08:16 02983_empty_map: [ OK ] 1.23 sec.
2026-02-18 05:08:16 01045_bloom_filter_null_array: [ OK ] 0.98 sec.
2026-02-18 05:08:17 01031_mutations_interpreter_and_context: [ OK ] 5.34 sec.
2026-02-18 05:08:17 01288_shard_max_network_bandwidth: [ OK ] 3.34 sec.
2026-02-18 05:08:17 03005_input_function_in_join: [ OK ] 0.64 sec.
2026-02-18 05:08:18 02766_bitshift_with_const_arguments: [ OK ] 0.93 sec.
2026-02-18 05:08:18 01143_trivial_count_with_join: [ OK ] 0.88 sec.
2026-02-18 05:08:19 00218_like_regexp_newline: [ OK ] 0.72 sec.
2026-02-18 05:08:19 02792_alter_table_modify_comment: [ OK ] 1.84 sec.
2026-02-18 05:08:19 01232_untuple: [ OK ] 0.92 sec.
2026-02-18 05:08:20 01853_s2_cells_intersect: [ OK ] 0.83 sec.
2026-02-18 05:08:20 01081_demangle: [ OK ] 0.73 sec.
2026-02-18 05:08:21 03134_positional_arguments: [ OK ] 4.45 sec.
2026-02-18 05:08:21 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 1.73 sec.
2026-02-18 05:08:21 02335_column_ttl_expired_column_optimization: [ OK ] 1.78 sec.
2026-02-18 05:08:22 00833_sleep_overflow: [ OK ] 0.58 sec.
2026-02-18 05:08:22 02676_kafka_murmur_hash: [ OK ] 0.68 sec.
2026-02-18 05:08:22 02784_parallel_replicas_automatic_decision: [ OK ] 19.25 sec.
2026-02-18 05:08:22 01669_test_toYear_mysql_dialect: [ OK ] 0.73 sec.
2026-02-18 05:08:23 00196_float32_formatting: [ OK ] 0.68 sec.
2026-02-18 05:08:23 00961_check_table: [ OK ] 0.98 sec.
2026-02-18 05:08:23 00380_client_break_at_exception_in_batch_mode: [ OK ] 1.78 sec.
2026-02-18 05:08:24 01353_neighbor_overflow: [ OK ] 0.63 sec.
2026-02-18 05:08:24 02900_issue_55858: [ OK ] 0.93 sec.
2026-02-18 05:08:24 02136_scalar_progress: [ OK ] 1.19 sec.
2026-02-18 05:08:25 00495_reading_const_zero_column: [ OK ] 0.83 sec.
2026-02-18 05:08:25 03203_variant_convert_field_to_type_bug: [ OK ] 0.78 sec.
2026-02-18 05:08:25 02523_range_const_start: [ OK ] 0.68 sec.
2026-02-18 05:08:25 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.83 sec.
2026-02-18 05:08:26 03003_enum_and_string_compatible: [ OK ] 0.73 sec.
2026-02-18 05:08:26 02383_array_signed_const_positive_index: [ OK ] 0.88 sec.
2026-02-18 05:08:26 02797_range_nullable: [ OK ] 0.88 sec.
2026-02-18 05:08:26 02981_variant_type_function: [ OK ] 0.78 sec.
2026-02-18 05:08:27 02688_aggregate_states: [ OK ] 1.28 sec.
2026-02-18 05:08:28 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 37.47 sec.
2026-02-18 05:08:28 01423_if_nullable_cond: [ OK ] 0.73 sec.
2026-02-18 05:08:28 03065_analyzer_cross_join_and_array_join: [ OK ] 0.73 sec.
2026-02-18 05:08:29 00842_array_with_constant_overflow: [ OK ] 0.77 sec.
2026-02-18 05:08:30 00700_decimal_complex_types: [ OK ] 3.09 sec.
2026-02-18 05:08:31 00662_array_has_nullable: [ OK ] 1.38 sec.
2026-02-18 05:08:32 02439_merge_selecting_partitions: [ OK ] 5.59 sec.
2026-02-18 05:08:32 01384_bloom_filter_bad_arguments: [ OK ] 0.98 sec.
2026-02-18 05:08:32 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec.
2026-02-18 05:08:32 Reason: not running for current build
2026-02-18 05:08:32 02933_sqid: [ OK ] 3.79 sec.
2026-02-18 05:08:33 00328_long_case_construction: [ OK ] 49.92 sec.
2026-02-18 05:08:33 02319_sql_standard_create_drop_index: [ OK ] 1.03 sec.
2026-02-18 05:08:33 03171_direct_dict_short_circuit_bug: [ OK ] 0.98 sec.
2026-02-18 05:08:34 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.73 sec.
2026-02-18 05:08:34 02104_clickhouse_local_columns_description: [ OK ] 1.33 sec.
2026-02-18 05:08:34 03020_output_format_client: [ OK ] 4.75 sec.
2026-02-18 05:08:34 01072_select_constant_limit: [ OK ] 0.83 sec.
2026-02-18 05:08:34 00534_functions_bad_arguments7: [ SKIPPED ] 0.00 sec.
2026-02-18 05:08:34 Reason: not running for current build
2026-02-18 05:08:35 03224_json_merges_new_type_in_shared_data: [ OK ] 0.93 sec.
2026-02-18 05:08:35 01937_nested_chinese: [ OK ] 0.83 sec.
2026-02-18 05:08:36 03299_deep_nested_map_creation: [ OK ] 0.78 sec.
2026-02-18 05:08:36 00097_long_storage_buffer_race_condition: [ OK ] 30.49 sec.
2026-02-18 05:08:36 03202_dynamic_null_map_subcolumn: [ OK ] 2.69 sec.
2026-02-18 05:08:36 02998_analyzer_secret_args_tree_node: [ OK ] 0.68 sec.
2026-02-18 05:08:36 02353_isnullable: [ OK ] 0.68 sec.
2026-02-18 05:08:37 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.69 sec.
2026-02-18 05:08:37 01922_sum_null_for_remote: [ OK ] 0.67 sec.
2026-02-18 05:08:37 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.93 sec.
2026-02-18 05:08:38 01505_pipeline_executor_UAF: [ OK ] 15.28 sec.
2026-02-18 05:08:38 02575_map_hashing_msan: [ OK ] 0.88 sec.
2026-02-18 05:08:38 01882_total_rows_approx: [ OK ] 3.69 sec.
2026-02-18 05:08:38 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.78 sec.
2026-02-18 05:08:39 02875_json_array_as_string: [ OK ] 0.68 sec.
2026-02-18 05:08:39 00974_fix_join_on: [ OK ] 1.54 sec.
2026-02-18 05:08:39 01773_datetime64_add_ubsan: [ OK ] 0.63 sec.
2026-02-18 05:08:39 02771_jit_functions_comparison_crash: [ OK ] 0.94 sec.
2026-02-18 05:08:40 02346_fulltext_index_bug52019: [ OK ] 0.88 sec.
2026-02-18 05:08:40 01000_unneeded_substitutions_client: [ OK ] 1.84 sec.
2026-02-18 05:08:40 00098_l_union_all: [ OK ] 0.83 sec.
2026-02-18 05:08:40 00647_histogram: [ OK ] 0.73 sec.
2026-02-18 05:08:41 02563_async_insert_bad_data: [ OK ] 3.73 sec.
2026-02-18 05:08:41 02915_sleep_large_uint: [ OK ] 0.78 sec.
2026-02-18 05:08:41 00678_shard_funnel_window: [ OK ] 1.08 sec.
2026-02-18 05:08:41 02029_test_implemented_methods: [ OK ] 1.18 sec.
2026-02-18 05:08:42 01390_remove_injective_in_uniq: [ OK ] 0.93 sec.
2026-02-18 05:08:42 02999_scalar_subqueries_bug_1: [ OK ] 0.84 sec.
2026-02-18 05:08:43 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.58 sec.
2026-02-18 05:08:43 02560_regexp_denial_of_service: [ OK ] 1.68 sec.
2026-02-18 05:08:44 02949_parallel_replicas_in_subquery: [ OK ] 1.38 sec.
2026-02-18 05:08:44 01942_snowflakeIDToDateTime: [ OK ] 1.18 sec.
2026-02-18 05:08:44 00936_substring_utf8_non_const: [ OK ] 4.35 sec.
2026-02-18 05:08:44 03154_recursive_cte_distributed: [ OK ] 1.23 sec.
2026-02-18 05:08:45 01710_projections_optimize_aggregation_in_order: [ OK ] 11.74 sec.
2026-02-18 05:08:45 00975_json_hang: [ OK ] 1.03 sec.
2026-02-18 05:08:46 02286_tuple_numeric_identifier: [ OK ] 0.88 sec.
2026-02-18 05:08:46 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.88 sec.
2026-02-18 05:08:46 02381_arrow_dict_to_lc: [ OK ] 1.48 sec.
2026-02-18 05:08:46 02584_compressor_codecs: [ OK ] 2.18 sec.
2026-02-18 05:08:46 02125_lz4_compression_bug_TSKV: [ OK ] 12.18 sec.
2026-02-18 05:08:48 02026_arrayDifference_const: [ OK ] 2.58 sec.
2026-02-18 05:08:48 02579_fill_empty_chunk_analyzer: [ OK ] 2.33 sec.
2026-02-18 05:08:49 00937_ipv4_cidr_range: [ OK ] 2.83 sec.
2026-02-18 05:08:49 00653_verification_monotonic_data_load: [ OK ] 30.23 sec.
2026-02-18 05:08:49 01958_partial_hour_timezone: [ OK ] 0.83 sec.
2026-02-18 05:08:50 02525_analyzer_function_in_crash_fix: [ OK ] 0.98 sec.
2026-02-18 05:08:50 02461_alter_update_respect_part_column_type_bug: [ OK ] 4.24 sec.
2026-02-18 05:08:50 01710_projection_with_ast_rewrite_settings: [ OK ] 1.69 sec.
2026-02-18 05:08:51 01518_cast_nullable_virtual_system_column: [ OK ] 1.15 sec.
2026-02-18 05:08:51 01492_format_readable_quantity: [ OK ] 1.25 sec.
2026-02-18 05:08:51 02764_parallel_replicas_plain_merge_tree: [ OK ] 1.27 sec.
2026-02-18 05:08:51 02968_url_args: [ OK ] 0.82 sec.
2026-02-18 05:08:52 00280_hex_escape_sequence: [ OK ] 0.94 sec.
2026-02-18 05:08:52 01710_projection_with_mixed_pipeline: [ OK ] 1.49 sec.
2026-02-18 05:08:53 03142_window_function_limit_by: [ OK ] 2.04 sec.
2026-02-18 05:08:53 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec.
2026-02-18 05:08:53 Reason: not running for current build
2026-02-18 05:08:53 01104_distributed_numbers_test: [ OK ] 1.69 sec.
2026-02-18 05:08:54 02972_parallel_replicas_cte: [ OK ] 1.81 sec.
2026-02-18 05:08:55 03243_create_or_replace_view_dependency_check: [ OK ] 1.60 sec.
2026-02-18 05:08:56 00839_bitmask_negative: [ OK ] 1.44 sec.
2026-02-18 05:08:57 02237_lzma_bug: [ OK ] 13.44 sec.
2026-02-18 05:08:58 00014_select_from_table_with_nested: [ OK ] 1.29 sec.
2026-02-18 05:08:59 02918_optimize_count_for_merge_tables: [ OK ] 1.50 sec.
2026-02-18 05:09:01 02041_openssl_hash_functions_test: [ OK ] 1.60 sec.
2026-02-18 05:09:02 02122_parallel_formatting_JSONEachRow: [ OK ] 10.44 sec.
2026-02-18 05:09:03 01634_summap_nullable: [ OK ] 1.74 sec.
2026-02-18 05:09:05 00417_kill_query: [ OK ] 14.18 sec.
2026-02-18 05:09:06 02518_parquet_arrow_orc_boolean_value: [ OK ] 4.34 sec.
2026-02-18 05:09:06 01701_clear_projection_and_part_remove: [ OK ] 2.10 sec.
2026-02-18 05:09:07 01508_explain_header: [ OK ] 1.39 sec.
2026-02-18 05:09:07 00440_nulls_merge_tree: [ OK ] 1.07 sec.
2026-02-18 05:09:07 02179_degrees_radians: [ OK ] 1.66 sec.
2026-02-18 05:09:08 00164_not_chain: [ OK ] 0.86 sec.
2026-02-18 05:09:08 01518_nullable_aggregate_states2: [ OK ] 10.96 sec.
2026-02-18 05:09:08 01755_shard_pruning_with_literal: [ OK ] 1.70 sec.
2026-02-18 05:09:10 02845_domain_rfc_support_ipv6: [ OK ] 1.30 sec.
2026-02-18 05:09:10 01214_test_storage_merge_aliases_with_where: [ OK ] 2.47 sec.
2026-02-18 05:09:10 02811_parallel_replicas_prewhere_count: [ OK ] 1.81 sec.
2026-02-18 05:09:12 03166_mv_prewhere_duplicating_name_bug: [ OK ] 1.49 sec.
2026-02-18 05:09:12 01521_format_readable_time_delta2: [ OK ] 1.86 sec.
2026-02-18 05:09:13 02366_kql_func_ip: [ OK ] 5.62 sec.
2026-02-18 05:09:14 01446_json_strings_each_row: [ OK ] 32.42 sec.
2026-02-18 05:09:14 02935_format_with_arbitrary_types: [ OK ] 2.21 sec.
2026-02-18 05:09:15 01409_topK_merge: [ OK ] 1.37 sec.
2026-02-18 05:09:16 01781_merge_tree_deduplication: [ OK ] 4.70 sec.
2026-02-18 05:09:17 02675_predicate_push_down_filled_join_fix: [ OK ] 2.03 sec.
2026-02-18 05:09:17 02206_clickhouse_local_use_database: [ OK ] 3.57 sec.
2026-02-18 05:09:18 00937_test_use_header_csv: [ OK ] 24.30 sec.
2026-02-18 05:09:19 02421_simple_queries_for_opentelemetry: [ OK ] 25.14 sec.
2026-02-18 05:09:19 01529_union_distinct_and_setting_union_default_mode: [ OK ] 1.91 sec.
2026-02-18 05:09:21 00991_system_parts_race_condition_long: [ OK ] 34.99 sec.
2026-02-18 05:09:21 00653_monotonic_integer_cast: [ OK ] 1.69 sec.
2026-02-18 05:09:22 02244_ip_address_invalid_insert: [ OK ] 1.23 sec.
2026-02-18 05:09:23 03680_loop_table_function_access_check: [ OK ] 5.92 sec.
2026-02-18 05:09:23 00508_materialized_view_to: [ OK ] 0.78 sec.
2026-02-18 05:09:24 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 8.91 sec.
2026-02-18 05:09:24 00898_parsing_bad_diagnostic_message: [ OK ] 1.78 sec.
2026-02-18 05:09:24 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 4.77 sec.
2026-02-18 05:09:25 01940_point_in_polygon_ubsan: [ OK ] 0.73 sec.
2026-02-18 05:09:25 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 1.09 sec.
2026-02-18 05:09:25 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.98 sec.
2026-02-18 05:09:25 02723_param_exception_message_context: [ OK ] 1.89 sec.
2026-02-18 05:09:26 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.84 sec.
2026-02-18 05:09:26 01710_force_use_projection: [ OK ] 0.83 sec.
2026-02-18 05:09:26 00355_array_of_non_const_convertible_types: [ OK ] 0.73 sec.
2026-02-18 05:09:27 00914_replicate: [ OK ] 0.68 sec.
2026-02-18 05:09:27 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.78 sec.
2026-02-18 05:09:27 01079_alter_default_zookeeper_long: [ OK ] 1.28 sec.
2026-02-18 05:09:27 00799_function_dry_run: [ OK ] 0.88 sec.
2026-02-18 05:09:27 00534_functions_bad_arguments1: [ SKIPPED ] 0.00 sec.
2026-02-18 05:09:27 Reason: not running for current build
2026-02-18 05:09:28 02355_column_type_name_lc: [ OK ] 0.73 sec.
2026-02-18 05:09:28 01509_parallel_quorum_and_merge_long: [ OK ] 18.32 sec.
2026-02-18 05:09:28 01866_datetime64_cmp_with_constant: [ OK ] 1.03 sec.
2026-02-18 05:09:29 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec.
2026-02-18 05:09:29 Reason: not running for current build
2026-02-18 05:09:29 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 1.18 sec.
2026-02-18 05:09:29 03095_merge_and_buffer_tables: [ OK ] 0.98 sec.
2026-02-18 05:09:29 03039_recursive_cte_postgres_5: [ OK ] 1.13 sec.
2026-02-18 05:09:30 01283_max_threads_simple_query_optimization: [ OK ] 1.49 sec.
2026-02-18 05:09:31 02235_add_part_offset_virtual_column: [ OK ] 2.14 sec.
2026-02-18 05:09:31 01675_distributed_bytes_to_delay_insert: [ OK ] 6.00 sec.
2026-02-18 05:09:32 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 1.49 sec.
2026-02-18 05:09:32 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.68 sec.
2026-02-18 05:09:32 00111_shard_external_sort_distributed: [ OK ] 10.82 sec.
2026-02-18 05:09:32 02316_cast_to_ip_address_default_column: [ OK ] 0.78 sec.
2026-02-18 05:09:33 02343_analyzer_column_transformers_strict: [ OK ] 0.68 sec.
2026-02-18 05:09:33 01602_runningConcurrency: [ OK ] 1.03 sec.
2026-02-18 05:09:33 01650_expressions_merge_bug: [ OK ] 0.68 sec.
2026-02-18 05:09:34 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 4.40 sec.
2026-02-18 05:09:34 02723_jit_aggregation_bug_48120: [ OK ] 1.23 sec.
2026-02-18 05:09:34 02493_max_streams_for_merge_tree_reading: [ OK ] 2.40 sec.
2026-02-18 05:09:34 00370_duplicate_columns_in_subqueries: [ OK ] 0.83 sec.
2026-02-18 05:09:35 01683_intdiv_ubsan: [ OK ] 0.84 sec.
2026-02-18 05:09:35 02347_rank_corr_nan: [ OK ] 0.73 sec.
2026-02-18 05:09:35 02113_format_row: [ OK ] 0.67 sec.
2026-02-18 05:09:35 02155_dictionary_comment: [ OK ] 1.13 sec.
2026-02-18 05:09:35 02311_range_hashed_dictionary_range_cast: [ OK ] 0.73 sec.
2026-02-18 05:09:36 01602_modified_julian_day_msan: [ OK ] 0.73 sec.
2026-02-18 05:09:36 02911_cte_invalid_query_analysis: [ OK ] 0.78 sec.
2026-02-18 05:09:37 01381_for_each_with_states: [ OK ] 0.83 sec.
2026-02-18 05:09:37 00674_join_on_syntax: [ OK ] 2.43 sec.
2026-02-18 05:09:38 01278_variance_nonnegative: [ OK ] 1.03 sec.
2026-02-18 05:09:38 01356_initialize_aggregation: [ OK ] 0.83 sec.
2026-02-18 05:09:39 02366_explain_query_tree: [ OK ] 0.98 sec.
2026-02-18 05:09:41 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 4.85 sec.
2026-02-18 05:09:42 02210_processors_profile_log: [ OK ] 2.64 sec.
2026-02-18 05:09:43 02888_obsolete_settings: [ OK ] 0.78 sec.
2026-02-18 05:09:43 02001_append_output_file: [ OK ] 2.20 sec.
2026-02-18 05:09:43 00900_orc_arrow_parquet_tuples: [ OK ] 11.56 sec.
2026-02-18 05:09:44 02496_remove_redundant_sorting_analyzer: [ OK ] 27.38 sec.
2026-02-18 05:09:44 01010_pm_join_all_join_bug: [ OK ] 0.78 sec.
2026-02-18 05:09:44 02592_avro_records_with_same_names: [ OK ] 1.48 sec.
2026-02-18 05:09:45 02291_dictionary_scalar_subquery_reload: [ OK ] 0.98 sec.
2026-02-18 05:09:45 02122_parallel_formatting_JSONStrings: [ OK ] 7.25 sec.
2026-02-18 05:09:46 01065_if_not_finite: [ OK ] 0.78 sec.
2026-02-18 05:09:46 02595_orc_arrow_parquet_more_types: [ OK ] 2.99 sec.
2026-02-18 05:09:47 02812_pointwise_array_operations: [ OK ] 1.13 sec.
2026-02-18 05:09:47 00296_url_parameters: [ OK ] 1.03 sec.
2026-02-18 05:09:48 00340_squashing_insert_select: [ OK ] 3.59 sec.
2026-02-18 05:09:48 02918_gorilla_invalid_file: [ OK ] 1.33 sec.
2026-02-18 05:09:49 03032_rmt_create_columns_from_replica: [ OK ] 0.58 sec.
2026-02-18 05:09:49 01960_lambda_precedence: [ OK ] 0.78 sec.
2026-02-18 05:09:50 00338_replicate_array_of_strings: [ OK ] 0.83 sec.
2026-02-18 05:09:51 01567_system_processes_current_database: [ OK ] 0.63 sec.
2026-02-18 05:09:52 00445_join_nullable_keys: [ OK ] 1.80 sec.
2026-02-18 05:09:53 01825_new_type_json_8: [ OK ] 8.81 sec.
2026-02-18 05:09:53 01787_map_remote: [ OK ] 0.99 sec.
2026-02-18 05:09:54 00100_subquery_table_identifier: [ OK ] 4.89 sec.
2026-02-18 05:09:54 00939_limit_by_offset: [ OK ] 0.69 sec.
2026-02-18 05:09:56 00934_is_valid_utf8: [ OK ] 1.88 sec.
2026-02-18 05:09:56 01317_no_password_in_command_line: [ OK ] 9.41 sec.
2026-02-18 05:09:57 01324_settings_documentation: [ OK ] 0.73 sec.
2026-02-18 05:09:57 01615_two_args_function_index_fix: [ OK ] 0.83 sec.
2026-02-18 05:09:57 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.68 sec.
2026-02-18 05:09:58 02374_analyzer_join_using: [ OK ] 3.94 sec.
2026-02-18 05:09:58 01655_sleep_infinite_float: [ OK ] 0.63 sec.
2026-02-18 05:09:58 00742_require_join_strictness: [ OK ] 0.68 sec.
2026-02-18 05:09:59 01323_if_with_nulls: [ OK ] 1.03 sec.
2026-02-18 05:09:59 00476_pretty_formats_and_widths: [ OK ] 0.98 sec.
2026-02-18 05:09:59 00421_storage_merge__table_index: [ OK ] 30.04 sec.
2026-02-18 05:09:59 03098_prefer_column_to_alias_subquery: [ OK ] 0.98 sec.
2026-02-18 05:09:59 02184_ipv6_select_parsing: [ OK ] 0.73 sec.
2026-02-18 05:09:59 02693_multiple_joins_in: [ OK ] 0.78 sec.
2026-02-18 05:10:00 01189_create_as_table_as_table_function: [ OK ] 0.68 sec.
2026-02-18 05:10:00 01509_check_many_parallel_quorum_inserts_long: [ OK ] 14.38 sec.
2026-02-18 05:10:01 01710_minmax_count_projection_constant_query: [ OK ] 0.83 sec.
2026-02-18 05:10:01 00740_optimize_predicate_expression: [ OK ] 1.13 sec.
2026-02-18 05:10:02 01622_constraints_simple_optimization: [ OK ] 2.49 sec.
2026-02-18 05:10:02 03199_merge_filters_bug: [ OK ] 1.03 sec.
2026-02-18 05:10:03 02933_group_by_memory_usage: [ OK ] 3.99 sec.
2026-02-18 05:10:03 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec.
2026-02-18 05:10:03 Reason: not running for current build
2026-02-18 05:10:03 02041_test_fuzzy_alter: [ OK ] 0.83 sec.
2026-02-18 05:10:03 00760_insert_json_with_defaults: [ OK ] 1.03 sec.
2026-02-18 05:10:03 02025_storage_filelog_virtual_col: [ OK ] 9.87 sec.
2026-02-18 05:10:04 02377_optimize_sorting_by_input_stream_properties: [ OK ] 1.23 sec.
2026-02-18 05:10:04 01710_projection_external_aggregate: [ OK ] 0.83 sec.
2026-02-18 05:10:04 01881_create_as_tuple: [ OK ] 0.83 sec.
2026-02-18 05:10:05 02891_alter_update_adaptive_granularity: [ OK ] 0.78 sec.
2026-02-18 05:10:05 02908_Npy_files_caching: [ OK ] 3.54 sec.
2026-02-18 05:10:05 01013_totals_without_aggregation: [ OK ] 0.83 sec.
2026-02-18 05:10:05 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2026-02-18 05:10:05 Reason: not running for current build
2026-02-18 05:10:05 00910_client_window_size_detection: [ OK ] 2.48 sec.
2026-02-18 05:10:06 01359_codeql: [ OK ] 0.68 sec.
2026-02-18 05:10:06 02874_json_merge_patch_function_test: [ OK ] 1.02 sec.
2026-02-18 05:10:07 01655_plan_optimizations: [ OK ] 32.14 sec.
2026-02-18 05:10:07 00929_multi_match_edit_distance: [ OK ] 3.59 sec.
2026-02-18 05:10:08 01056_predicate_optimizer_bugs: [ OK ] 1.63 sec.
2026-02-18 05:10:08 02408_to_fixed_string_short_circuit: [ OK ] 0.68 sec.
2026-02-18 05:10:08 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 2.69 sec.
2026-02-18 05:10:08 00745_compile_scalar_subquery: [ OK ] 0.93 sec.
2026-02-18 05:10:09 01581_deduplicate_by_columns_replicated_long: [ OK ] 1.38 sec.
2026-02-18 05:10:09 02269_to_start_of_interval_overflow: [ OK ] 0.67 sec.
2026-02-18 05:10:10 03058_analyzer_ambiguous_columns: [ OK ] 0.89 sec.
2026-02-18 05:10:11 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.78 sec.
2026-02-18 05:10:12 02841_parallel_replicas_summary: [ OK ] 3.94 sec.
2026-02-18 05:10:13 03012_parser_backtracking: [ OK ] 13.73 sec.
2026-02-18 05:10:13 01583_parallel_parsing_exception_with_offset: [ OK ] 7.75 sec.
2026-02-18 05:10:14 01058_window_view_event_hop_to_strict_asc: [ OK ] 5.79 sec.
2026-02-18 05:10:14 00700_to_decimal_or_something_1: [ OK ] 2.79 sec.
2026-02-18 05:10:14 02861_join_on_nullsafe_compare: [ OK ] 2.08 sec.
2026-02-18 05:10:14 02021_prewhere_column_optimization: [ OK ] 0.73 sec.
2026-02-18 05:10:14 02422_read_numbers_as_strings: [ OK ] 0.68 sec.
2026-02-18 05:10:14 01818_case_float_value_fangyc: [ OK ] 0.63 sec.
2026-02-18 05:10:15 00821_distributed_storage_with_join_on: [ OK ] 0.78 sec.
2026-02-18 05:10:15 00564_temporary_table_management: [ OK ] 0.58 sec.
2026-02-18 05:10:15 00860_unknown_identifier_bug: [ OK ] 0.78 sec.
2026-02-18 05:10:15 02243_in_ip_address: [ OK ] 0.78 sec.
2026-02-18 05:10:16 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.98 sec.
2026-02-18 05:10:16 00354_host_command_line_option: [ OK ] 3.23 sec.
2026-02-18 05:10:16 03034_recursive_cte_tree: [ OK ] 1.08 sec.
2026-02-18 05:10:16 01202_array_auc_special: [ OK ] 1.08 sec.
2026-02-18 05:10:16 02994_merge_tree_mutations_cleanup: [ OK ] 11.06 sec.
2026-02-18 05:10:17 01674_clickhouse_client_query_param_cte: [ OK ] 1.93 sec.
2026-02-18 05:10:17 01771_datetime64_no_time_part: [ OK ] 0.67 sec.
2026-02-18 05:10:17 00591_columns_removal_union_all: [ OK ] 0.68 sec.
2026-02-18 05:10:17 03150_grouping_sets_use_nulls_pushdown: [ OK ] 1.12 sec.
2026-02-18 05:10:17 00098_1_union_all: [ OK ] 0.88 sec.
2026-02-18 05:10:18 02325_compatibility_setting_2: [ OK ] 0.88 sec.
2026-02-18 05:10:18 02871_join_on_system_errors: [ OK ] 0.69 sec.
2026-02-18 05:10:18 03167_parametrized_view_with_cte: [ OK ] 0.78 sec.
2026-02-18 05:10:18 02922_respect_nulls_extensive: [ OK ] 1.48 sec.
2026-02-18 05:10:18 02521_analyzer_array_join_crash: [ OK ] 0.92 sec.
2026-02-18 05:10:18 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.68 sec.
2026-02-18 05:10:19 01549_low_cardinality_materialized_view: [ OK ] 0.83 sec.
2026-02-18 05:10:19 01410_nullable_key_and_index: [ OK ] 1.48 sec.
2026-02-18 05:10:19 03150_url_hash_non_constant_level: [ OK ] 0.78 sec.
2026-02-18 05:10:19 02097_initializeAggregationNullable: [ OK ] 0.78 sec.
2026-02-18 05:10:19 01087_index_set_ubsan: [ OK ] 0.74 sec.
2026-02-18 05:10:20 01550_mutation_subquery: [ OK ] 0.78 sec.
2026-02-18 05:10:20 00974_full_outer_join: [ OK ] 0.67 sec.
2026-02-18 05:10:21 02474_fix_function_parser_bug: [ OK ] 0.58 sec.
2026-02-18 05:10:21 00717_merge_and_distributed: [ OK ] 2.18 sec.
2026-02-18 05:10:21 02716_int256_arrayfunc: [ OK ] 0.98 sec.
2026-02-18 05:10:21 02002_row_level_filter_bug: [ OK ] 12.22 sec.
2026-02-18 05:10:21 03173_distinct_combinator_alignment: [ OK ] 0.63 sec.
2026-02-18 05:10:21 02045_like_function: [ OK ] 0.63 sec.
2026-02-18 05:10:22 00041_aggregation_remap: [ OK ] 0.73 sec.
2026-02-18 05:10:22 00951_ngram_search: [ OK ] 3.15 sec.
2026-02-18 05:10:22 02539_generate_random_ip: [ OK ] 0.73 sec.
2026-02-18 05:10:22 02674_date_int_string_json_inference: [ OK ] 0.68 sec.
2026-02-18 05:10:22 00737_decimal_group_by: [ OK ] 0.94 sec.
2026-02-18 05:10:23 02013_json_function_null_column: [ OK ] 1.18 sec.
2026-02-18 05:10:23 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.63 sec.
2026-02-18 05:10:23 02428_parameterized_view: [ OK ] 65.25 sec.
2026-02-18 05:10:24 02265_per_table_ttl_mutation_on_change: [ OK ] 1.28 sec.
2026-02-18 05:10:24 02994_inconsistent_formatting: [ OK ] 0.68 sec.
2026-02-18 05:10:24 02382_analyzer_matcher_join_using: [ OK ] 1.28 sec.
2026-02-18 05:10:24 00910_buffer_prewhere: [ OK ] 0.78 sec.
2026-02-18 05:10:25 02792_drop_projection_lwd: [ OK ] 0.83 sec.
2026-02-18 05:10:25 01458_count_digits: [ OK ] 0.83 sec.
2026-02-18 05:10:25 00160_merge_and_index_in_in: [ OK ] 6.71 sec.
2026-02-18 05:10:25 00837_minmax_index: [ OK ] 6.55 sec.
2026-02-18 05:10:25 02935_ipv6_bit_operations: [ OK ] 0.68 sec.
2026-02-18 05:10:25 02864_statistics_predicates: [ OK ] 3.29 sec.
2026-02-18 05:10:26 02369_analyzer_array_join_function: [ OK ] 1.08 sec.
2026-02-18 05:10:26 02702_allow_skip_errors_enum: [ OK ] 4.04 sec.
2026-02-18 05:10:26 00609_prewhere_and_default: [ OK ] 1.28 sec.
2026-02-18 05:10:26 02478_window_frame_type_groups: [ OK ] 0.73 sec.
2026-02-18 05:10:26 01186_conversion_to_nullable: [ OK ] 0.73 sec.
2026-02-18 05:10:27 02011_normalize_utf8: [ OK ] 1.18 sec.
2026-02-18 05:10:27 01622_defaults_for_url_engine: [ OK ] 1.93 sec.
2026-02-18 05:10:27 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.78 sec.
2026-02-18 05:10:27 01093_cyclic_defaults_filimonov: [ OK ] 0.84 sec.
2026-02-18 05:10:27 02734_sparse_columns_mutation: [ OK ] 0.97 sec.
2026-02-18 05:10:27 01413_alter_update_supertype: [ OK ] 0.78 sec.
2026-02-18 05:10:28 02515_aggregate_functions_statistics: [ OK ] 1.08 sec.
2026-02-18 05:10:29 00823_sequence_match_dfa: [ OK ] 2.08 sec.
2026-02-18 05:10:29 01330_array_join_in_higher_order_function: [ OK ] 0.63 sec.
2026-02-18 05:10:29 02902_select_subcolumns_from_engine_null: [ OK ] 0.68 sec.
2026-02-18 05:10:30 00453_cast_enum: [ OK ] 0.83 sec.
2026-02-18 05:10:30 01273_arrow_nested_arrays_load: [ OK ] 5.64 sec.
2026-02-18 05:10:30 00116_storage_set: [ OK ] 0.93 sec.
2026-02-18 05:10:31 01513_defaults_on_defaults_no_column: [ OK ] 0.78 sec.
2026-02-18 05:10:31 02973_parse_crlf_with_tsv_files: [ OK ] 3.03 sec.
2026-02-18 05:10:31 02122_parallel_formatting_TSV: [ OK ] 4.14 sec.
2026-02-18 05:10:31 02900_clickhouse_local_drop_current_database: [ OK ] 1.53 sec.
2026-02-18 05:10:31 01552_dict_fixedstring: [ OK ] 0.83 sec.
2026-02-18 05:10:32 00392_enum_nested_alter: [ OK ] 1.48 sec.
2026-02-18 05:10:32 03062_analyzer_join_engine_missing_column: [ OK ] 0.83 sec.
2026-02-18 05:10:32 00552_logical_functions_uint8_as_bool: [ OK ] 0.68 sec.
2026-02-18 05:10:33 00612_union_query_with_subquery: [ OK ] 0.73 sec.
2026-02-18 05:10:33 01412_row_from_totals: [ OK ] 0.93 sec.
2026-02-18 05:10:34 02240_asof_join_biginteger: [ OK ] 0.79 sec.
2026-02-18 05:10:34 02241_parquet_bad_column: [ OK ] 7.30 sec.
2026-02-18 05:10:35 01293_external_sorting_limit_bug: [ OK ] 0.78 sec.
2026-02-18 05:10:36 01018_ddl_dictionaries_special: [ OK ] 1.33 sec.
2026-02-18 05:10:36 02015_async_inserts_4: [ OK ] 11.66 sec.
2026-02-18 05:10:36 01550_type_map_formats_input: [ OK ] 9.37 sec.
2026-02-18 05:10:36 01811_storage_buffer_flush_parameters: [ OK ] 5.44 sec.
2026-02-18 05:10:36 03198_unload_primary_key_outdated: [ OK ] 4.29 sec.
2026-02-18 05:10:36 02911_system_symbols: [ OK ] 1.58 sec.
2026-02-18 05:10:36 01040_h3_get_resolution: [ OK ] 0.62 sec.
2026-02-18 05:10:37 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.68 sec.
2026-02-18 05:10:37 03203_fill_missed_subcolumns: [ OK ] 1.03 sec.
2026-02-18 05:10:37 03093_with_fill_support_constant_expression: [ OK ] 0.67 sec.
2026-02-18 05:10:37 01822_union_and_constans_error: [ OK ] 0.78 sec.
2026-02-18 05:10:38 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.83 sec.
2026-02-18 05:10:38 01913_fix_column_transformer_replace_format: [ OK ] 0.63 sec.
2026-02-18 05:10:38 01293_client_interactive_vertical_singleline: [ OK ] 1.88 sec.
2026-02-18 05:10:38 01710_minmax_count_projection_distributed_query: [ OK ] 0.78 sec.
2026-02-18 05:10:38 00293_shard_max_subquery_depth: [ OK ] 0.88 sec.
2026-02-18 05:10:39 01651_map_functions: [ OK ] 1.78 sec.
2026-02-18 05:10:39 02378_part_log_profile_events: [ OK ] 2.58 sec.
2026-02-18 05:10:39 00714_alter_uuid: [ OK ] 1.13 sec.
2026-02-18 05:10:39 02475_or_function_alias_and_const_where: [ OK ] 0.78 sec.
2026-02-18 05:10:40 02807_lower_utf8_msan: [ OK ] 0.78 sec.
2026-02-18 05:10:40 00353_join_by_tuple: [ OK ] 0.67 sec.
2026-02-18 05:10:41 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.68 sec.
2026-02-18 05:10:41 01289_min_execution_speed_not_too_early: [ OK ] 1.53 sec.
2026-02-18 05:10:41 02915_lazy_loading_of_base_backups: [ OK ] 9.77 sec.
2026-02-18 05:10:42 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.93 sec.
2026-02-18 05:10:42 01881_join_on_conditions_hash: [ OK ] 3.39 sec.
2026-02-18 05:10:42 03066_analyzer_global_with_statement: [ OK ] 0.63 sec.
2026-02-18 05:10:43 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.77 sec.
2026-02-18 05:10:43 02565_update_empty_nested: [ OK ] 0.93 sec.
2026-02-18 05:10:45 00596_limit_on_expanded_ast: [ OK ] 1.98 sec.
2026-02-18 05:10:45 02020_exponential_smoothing: [ OK ] 2.54 sec.
2026-02-18 05:10:46 01264_nested_baloo_bear: [ OK ] 0.83 sec.
2026-02-18 05:10:46 02988_join_using_prewhere_pushdown: [ OK ] 0.68 sec.
2026-02-18 05:10:47 01620_fix_simple_state_arg_type: [ OK ] 0.98 sec.
2026-02-18 05:10:48 02741_hashed_dictionary_load_factor: [ OK ] 2.08 sec.
2026-02-18 05:10:49 02864_replace_regexp_string_fallback: [ OK ] 0.83 sec.
2026-02-18 05:10:49 02383_join_and_filtering_set: [ OK ] 8.46 sec.
2026-02-18 05:10:50 03155_explain_current_transaction: [ OK ] 0.73 sec.
2026-02-18 05:10:50 03215_parsing_archive_name_s3: [ OK ] 1.19 sec.
2026-02-18 05:10:51 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.93 sec.
2026-02-18 05:10:52 02266_protobuf_format_google_wrappers: [ OK ] 10.27 sec.
2026-02-18 05:10:52 02416_keeper_map: [ OK ] 2.14 sec.
2026-02-18 05:10:53 02247_read_bools_as_numbers_json: [ OK ] 13.92 sec.
2026-02-18 05:10:53 01259_datetime64_ubsan: [ OK ] 0.63 sec.
2026-02-18 05:10:53 02895_peak_memory_usage_http_headers_regression: [ OK ] 1.68 sec.
2026-02-18 05:10:53 01586_columns_pruning: [ OK ] 0.93 sec.
2026-02-18 05:10:53 01338_long_select_and_alter_zookeeper: [ OK ] 16.20 sec.
2026-02-18 05:10:53 00688_low_cardinality_defaults: [ OK ] 0.68 sec.
2026-02-18 05:10:53 02493_analyzer_sum_if_to_count_if: [ OK ] 0.73 sec.
2026-02-18 05:10:54 03165_storage_merge_view_prewhere: [ OK ] 0.88 sec.
2026-02-18 05:10:54 03212_thousand_exceptions: [ OK ] 21.35 sec.
2026-02-18 05:10:54 01710_projection_with_nullable_keys: [ OK ] 0.58 sec.
2026-02-18 05:10:54 03011_adaptative_timeout_compatibility: [ OK ] 0.73 sec.
2026-02-18 05:10:55 01017_in_unconvertible_complex_type: [ OK ] 0.89 sec.
2026-02-18 05:10:55 02956_clickhouse_local_system_parts: [ OK ] 1.84 sec.
2026-02-18 05:10:55 01116_cross_count_asterisks: [ OK ] 0.87 sec.
2026-02-18 05:10:55 03031_clickhouse_local_input: [ OK ] 2.28 sec.
2026-02-18 05:10:56 02267_special_operator_parse_alias_check: [ OK ] 1.60 sec.
2026-02-18 05:10:56 02498_storage_join_key_positions: [ OK ] 2.29 sec.
2026-02-18 05:10:56 00999_join_not_nullable_types: [ OK ] 0.74 sec.
2026-02-18 05:10:56 00910_crash_when_distributed_modify_order_by: [ OK ] 0.69 sec.
2026-02-18 05:10:56 02119_sumcount: [ OK ] 1.18 sec.
2026-02-18 05:10:56 02889_print_pretty_type_names: [ OK ] 0.77 sec.
2026-02-18 05:10:56 02686_bson3: [ OK ] 0.78 sec.
2026-02-18 05:10:57 01592_toUnixTimestamp_Date: [ OK ] 0.78 sec.
2026-02-18 05:10:57 01045_array_zip: [ OK ] 0.77 sec.
2026-02-18 05:10:57 00545_weird_aggregate_functions: [ OK ] 0.83 sec.
2026-02-18 05:10:57 03002_int_div_decimal_with_date_bug: [ OK ] 0.73 sec.
2026-02-18 05:10:58 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.98 sec.
2026-02-18 05:10:58 00952_basic_constraints: [ OK ] 10.76 sec.
2026-02-18 05:10:58 03157_dynamic_type_json: [ OK ] 0.88 sec.
2026-02-18 05:10:58 00437_nulls_first_last: [ OK ] 1.28 sec.
2026-02-18 05:10:58 02133_issue_32458: [ OK ] 0.83 sec.
2026-02-18 05:10:59 01070_h3_to_parent: [ OK ] 0.68 sec.
2026-02-18 05:10:59 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.88 sec.
2026-02-18 05:11:00 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.63 sec.
2026-02-18 05:11:00 01115_join_with_dictionary: [ OK ] 2.03 sec.
2026-02-18 05:11:00 02932_group_by_null_fuzzer: [ OK ] 0.78 sec.
2026-02-18 05:11:01 01471_top_k_range_check: [ OK ] 0.57 sec.
2026-02-18 05:11:01 02129_add_column_add_ttl: [ OK ] 1.23 sec.
2026-02-18 05:11:01 00404_null_literal: [ OK ] 0.78 sec.
2026-02-18 05:11:02 00604_show_create_database: [ OK ] 0.53 sec.
2026-02-18 05:11:02 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.83 sec.
2026-02-18 05:11:03 01646_fix_window_funnel_inconistency: [ OK ] 0.88 sec.
2026-02-18 05:11:03 00981_no_virtual_columns: [ OK ] 0.78 sec.
2026-02-18 05:11:04 02016_summing_mt_aggregating_column: [ OK ] 0.93 sec.
2026-02-18 05:11:04 00416_pocopatch_progress_in_http_headers: [ OK ] 1.68 sec.
2026-02-18 05:11:05 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 8.86 sec.
2026-02-18 05:11:05 01825_new_type_json_distributed: [ OK ] 0.83 sec.
2026-02-18 05:11:06 00098_a_union_all: [ OK ] 0.77 sec.
2026-02-18 05:11:06 00515_enhanced_time_zones: [ OK ] 2.04 sec.
2026-02-18 05:11:06 02933_replicated_database_forbid_create_as_select: [ OK ] 7.86 sec.
2026-02-18 05:11:07 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.68 sec.
2026-02-18 05:11:07 02457_tuple_of_intervals: [ OK ] 1.38 sec.
2026-02-18 05:11:08 00954_client_prepared_statements: [ OK ] 11.66 sec.
2026-02-18 05:11:08 02872_null_as_default_nested: [ OK ] 8.16 sec.
2026-02-18 05:11:09 02160_h3_cell_area_m2: [ OK ] 0.83 sec.
2026-02-18 05:11:09 01526_initial_query_id: [ OK ] 3.59 sec.
2026-02-18 05:11:09 02922_server_exit_code: [ OK ] 1.63 sec.
2026-02-18 05:11:10 02113_base64encode_trailing_bytes_1: [ OK ] 0.77 sec.
2026-02-18 05:11:10 02293_grouping_function_group_by: [ OK ] 1.33 sec.
2026-02-18 05:11:10 02502_analyzer_insert_select_crash_fix: [ OK ] 0.83 sec.
2026-02-18 05:11:11 02783_date_predicate_optimizations: [ OK ] 3.29 sec.
2026-02-18 05:11:11 02285_hex_bin_support_more_types: [ OK ] 0.93 sec.
2026-02-18 05:11:11 00700_decimal_casts: [ OK ] 2.94 sec.
2026-02-18 05:11:11 01720_engine_file_empty_if_not_exists: [ OK ] 0.78 sec.
2026-02-18 05:11:11 03039_dynamic_aggregating_merge_tree: [ OK ] 31.24 sec.
2026-02-18 05:11:12 02394_every_profile_event_must_have_documentation: [ OK ] 0.78 sec.
2026-02-18 05:11:12 02907_backup_restore_flatten_nested: [ OK ] 6.00 sec.
2026-02-18 05:11:12 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:12 Reason: not running for current build
2026-02-18 05:11:12 00725_memory_tracking: [ OK ] 1.63 sec.
2026-02-18 05:11:12 01280_min_map_max_map: [ OK ] 1.18 sec.
2026-02-18 05:11:13 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 1.84 sec.
2026-02-18 05:11:13 02721_parquet_field_not_found: [ OK ] 1.94 sec.
2026-02-18 05:11:13 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.83 sec.
2026-02-18 05:11:14 01076_predicate_optimizer_with_view: [ OK ] 0.93 sec.
2026-02-18 05:11:14 00594_alias_in_distributed: [ OK ] 1.48 sec.
2026-02-18 05:11:14 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 1.14 sec.
2026-02-18 05:11:15 03217_filtering_in_storage_merge: [ OK ] 0.73 sec.
2026-02-18 05:11:15 01921_datatype_date32: [ OK ] 2.54 sec.
2026-02-18 05:11:15 01056_prepared_statements_null_and_escaping: [ OK ] 1.48 sec.
2026-02-18 05:11:15 00155_long_merges: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:15 Reason: not running for current build
2026-02-18 05:11:16 01710_projections_order_by_complete: [ OK ] 0.83 sec.
2026-02-18 05:11:16 00875_join_right_nulls: [ OK ] 1.23 sec.
2026-02-18 05:11:16 02212_h3_get_pentagon_indexes: [ OK ] 0.89 sec.
2026-02-18 05:11:16 00034_fixed_string_to_number: [ OK ] 0.73 sec.
2026-02-18 05:11:17 02129_window_functions_disable_optimizations: [ OK ] 0.73 sec.
2026-02-18 05:11:17 00725_join_on_bug_3: [ OK ] 0.83 sec.
2026-02-18 05:11:18 00930_arrayIntersect: [ OK ] 1.03 sec.
2026-02-18 05:11:18 02245_s3_schema_desc: [ OK ] 0.98 sec.
2026-02-18 05:11:18 02414_all_new_table_functions_must_be_documented: [ OK ] 0.68 sec.
2026-02-18 05:11:19 02021_create_database_with_comment: [ OK ] 6.41 sec.
2026-02-18 05:11:19 02389_analyzer_nested_lambda: [ OK ] 10.51 sec.
2026-02-18 05:11:19 02179_bool_type: [ OK ] 1.09 sec.
2026-02-18 05:11:20 02815_range_dict_no_direct_join: [ OK ] 0.85 sec.
2026-02-18 05:11:20 03144_alter_column_and_read: [ OK ] 0.83 sec.
2026-02-18 05:11:20 01825_type_json_in_other_types: [ OK ] 7.61 sec.
2026-02-18 05:11:20 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:20 Reason: not running for current build
2026-02-18 05:11:21 00968_roundAge: [ OK ] 0.73 sec.
2026-02-18 05:11:21 00284_external_aggregation_2: [ OK ] 6.85 sec.
2026-02-18 05:11:21 01131_max_rows_to_sort: [ OK ] 0.68 sec.
2026-02-18 05:11:21 02973_block_number_sparse_serialization_and_mutation: [ OK ] 1.28 sec.
2026-02-18 05:11:21 01938_joins_identifiers: [ OK ] 0.88 sec.
2026-02-18 05:11:21 00183_skip_unavailable_shards: [ OK ] 24.98 sec.
2026-02-18 05:11:22 02932_kill_query_sleep: [ OK ] 4.85 sec.
2026-02-18 05:11:22 02906_flatten_only_true_nested: [ OK ] 0.72 sec.
2026-02-18 05:11:22 00120_join_and_group_by: [ OK ] 0.68 sec.
2026-02-18 05:11:22 01069_insert_float_as_nullable_unit8: [ OK ] 0.68 sec.
2026-02-18 05:11:22 01538_fuzz_aggregate: [ OK ] 0.58 sec.
2026-02-18 05:11:23 02052_last_granula_adjust_logical_error: [ OK ] 1.43 sec.
2026-02-18 05:11:23 03207_json_read_subcolumns_1_memory: [ OK ] 3.39 sec.
2026-02-18 05:11:23 02426_pod_array_overflow_2: [ OK ] 0.68 sec.
2026-02-18 05:11:23 00569_parse_date_time_best_effort: [ OK ] 0.58 sec.
2026-02-18 05:11:23 01923_different_expression_name_alias: [ OK ] 0.88 sec.
2026-02-18 05:11:23 01273_h3EdgeAngle_range_check: [ OK ] 0.73 sec.
2026-02-18 05:11:24 01940_totimezone_operator_monotonicity: [ OK ] 0.73 sec.
2026-02-18 05:11:24 03146_bug47862: [ OK ] 0.62 sec.
2026-02-18 05:11:24 02813_func_today_and_alias: [ OK ] 0.73 sec.
2026-02-18 05:11:24 00215_primary_key_order_zookeeper_long: [ OK ] 0.93 sec.
2026-02-18 05:11:24 00154_shard_distributed_with_distinct: [ OK ] 0.67 sec.
2026-02-18 05:11:24 01319_query_formatting_in_server_log: [ OK ] 1.49 sec.
2026-02-18 05:11:25 02887_tuple_element_distributed: [ OK ] 0.63 sec.
2026-02-18 05:11:25 00986_materialized_view_stack_overflow: [ OK ] 1.74 sec.
2026-02-18 05:11:25 01880_materialized_view_to_table_type_check: [ OK ] 0.93 sec.
2026-02-18 05:11:26 02941_projections_external_aggregation: [ OK ] 2.08 sec.
2026-02-18 05:11:26 02967_parallel_replicas_joins_and_analyzer: [ OK ] 4.44 sec.
2026-02-18 05:11:26 02782_avro_decimals: [ OK ] 1.68 sec.
2026-02-18 05:11:26 01413_if_array_uuid: [ OK ] 0.68 sec.
2026-02-18 05:11:26 00601_kill_running_query: [ OK ] 1.24 sec.
2026-02-18 05:11:26 02886_missed_json_subcolumns: [ OK ] 0.88 sec.
2026-02-18 05:11:27 02229_client_stop_multiquery_in_SIGINT: [ OK ] 7.96 sec.
2026-02-18 05:11:27 03287_dynamic_and_json_squashing_fix: [ OK ] 1.03 sec.
2026-02-18 05:11:27 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.28 sec.
2026-02-18 05:11:27 01891_partition_hash_no_long_int: [ OK ] 0.93 sec.
2026-02-18 05:11:28 00457_log_tinylog_stripelog_nullable: [ OK ] 1.24 sec.
2026-02-18 05:11:28 03040_recursive_cte_postgres_6: [ OK ] 1.58 sec.
2026-02-18 05:11:28 00834_kill_mutation_replicated_zookeeper: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:28 Reason: not running for current build
2026-02-18 05:11:28 02475_analysis_of_variance: [ OK ] 0.78 sec.
2026-02-18 05:11:28 02877_optimize_read_in_order_from_view: [ OK ] 6.00 sec.
2026-02-18 05:11:28 00298_enum_width_and_cast: [ OK ] 1.03 sec.
2026-02-18 05:11:28 01825_type_json_missed_values: [ OK ] 1.08 sec.
2026-02-18 05:11:28 02962_parallel_window_functions_different_partitioning: [ OK ] 0.78 sec.
2026-02-18 05:11:29 01019_materialized_view_select_extra_columns: [ OK ] 0.79 sec.
2026-02-18 05:11:29 02124_encrypt_decrypt_nullable: [ OK ] 0.88 sec.
2026-02-18 05:11:29 02187_test_final_and_limit_modifier: [ OK ] 0.77 sec.
2026-02-18 05:11:29 01554_row_number_after_cannot_read_all_data: [ OK ] 1.93 sec.
2026-02-18 05:11:30 00754_alter_modify_column_partitions: [ OK ] 1.28 sec.
2026-02-18 05:11:30 00165_transform_non_const_default: [ OK ] 0.83 sec.
2026-02-18 05:11:30 01825_new_type_json_parallel_insert: [ OK ] 0.98 sec.
2026-02-18 05:11:30 00422_hash_function_constexpr: [ OK ] 0.78 sec.
2026-02-18 05:11:30 01358_mutation_delete_null_rows: [ OK ] 1.04 sec.
2026-02-18 05:11:30 01214_point_in_Mecca: [ OK ] 2.51 sec.
2026-02-18 05:11:31 03105_table_aliases_in_mv: [ OK ] 0.83 sec.
2026-02-18 05:11:31 03199_queries_with_new_analyzer: [ OK ] 0.88 sec.
2026-02-18 05:11:31 01664_array_slice_ubsan: [ OK ] 0.72 sec.
2026-02-18 05:11:31 00502_sum_map: [ OK ] 1.28 sec.
2026-02-18 05:11:31 00114_float_type_result_of_division: [ OK ] 0.68 sec.
2026-02-18 05:11:32 03149_variant_pop_back_typo: [ OK ] 0.63 sec.
2026-02-18 05:11:32 02315_pmj_union_ubsan_35857: [ OK ] 0.68 sec.
2026-02-18 05:11:32 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:32 Reason: not running for current build
2026-02-18 05:11:32 02578_ipv4_codec_t64: [ OK ] 0.59 sec.
2026-02-18 05:11:32 02304_grouping_set_order_by: [ OK ] 0.58 sec.
2026-02-18 05:11:32 01414_low_cardinality_nullable: [ OK ] 2.64 sec.
2026-02-18 05:11:33 01386_negative_float_constant_key_condition: [ OK ] 0.83 sec.
2026-02-18 05:11:33 02833_sparse_columns_tuple_function: [ OK ] 0.73 sec.
2026-02-18 05:11:33 00465_nullable_default: [ OK ] 0.74 sec.
2026-02-18 05:11:34 02368_analyzer_table_functions: [ OK ] 0.83 sec.
2026-02-18 05:11:34 02793_implicit_pretty_format_settings: [ OK ] 1.73 sec.
2026-02-18 05:11:34 02815_alias_to_length: [ OK ] 0.73 sec.
2026-02-18 05:11:34 01600_encode_XML: [ OK ] 0.68 sec.
2026-02-18 05:11:34 03069_analyzer_with_alias_in_array_join: [ OK ] 0.62 sec.
2026-02-18 05:11:35 03215_grant_current_grants: [ OK ] 6.70 sec.
2026-02-18 05:11:35 02267_insert_empty_data: [ OK ] 0.63 sec.
2026-02-18 05:11:35 00880_decimal_in_key: [ OK ] 2.33 sec.
2026-02-18 05:11:36 01605_skip_idx_compact_parts: [ OK ] 0.73 sec.
2026-02-18 05:11:36 02016_agg_empty_result_bug_28880: [ OK ] 0.63 sec.
2026-02-18 05:11:36 01714_alter_drop_version: [ OK ] 0.83 sec.
2026-02-18 05:11:36 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.78 sec.
2026-02-18 05:11:37 03001_backup_matview_after_modify_query: [ OK ] 6.60 sec.
2026-02-18 05:11:37 02915_analyzer_fuzz_1: [ OK ] 0.77 sec.
2026-02-18 05:11:37 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.84 sec.
2026-02-18 05:11:37 02499_analyzer_set_index: [ OK ] 0.78 sec.
2026-02-18 05:11:37 03006_mv_deduplication_throw_if_async_insert: [ OK ] 1.28 sec.
2026-02-18 05:11:38 02810_row_binary_with_defaults: [ OK ] 0.78 sec.
2026-02-18 05:11:38 00098_shard_i_union_all: [ OK ] 0.88 sec.
2026-02-18 05:11:38 00578_merge_table_and_table_virtual_column: [ OK ] 1.14 sec.
2026-02-18 05:11:38 00940_max_parts_in_total: [ OK ] 0.83 sec.
2026-02-18 05:11:38 02918_join_pm_lc_crash: [ OK ] 0.78 sec.
2026-02-18 05:11:39 02251_last_day_of_month: [ OK ] 0.73 sec.
2026-02-18 05:11:39 01673_test_toMinute_mysql_dialect: [ OK ] 0.68 sec.
2026-02-18 05:11:40 02366_kql_create_table: [ OK ] 0.93 sec.
2026-02-18 05:11:40 01854_HTTP_dict_decompression: [ OK ] 2.24 sec.
2026-02-18 05:11:41 02840_merge__table_or_filter: [ OK ] 1.28 sec.
2026-02-18 05:11:41 03274_format_inference_create_query_file: [ OK ] 3.44 sec.
2026-02-18 05:11:42 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 10.66 sec.
2026-02-18 05:11:42 02725_cnf_large_check: [ OK ] 1.23 sec.
2026-02-18 05:11:42 02006_use_constants_in_with_and_select: [ OK ] 0.79 sec.
2026-02-18 05:11:43 02788_current_schemas_function: [ OK ] 0.78 sec.
2026-02-18 05:11:43 01412_group_array_moving_shard: [ OK ] 1.43 sec.
2026-02-18 05:11:43 02134_async_inserts_formats: [ OK ] 9.36 sec.
2026-02-18 05:11:44 02809_prewhere_and_in: [ OK ] 1.08 sec.
2026-02-18 05:11:44 00752_low_cardinality_lambda_argument: [ OK ] 0.83 sec.
2026-02-18 05:11:44 01155_old_mutation_parts_to_do: [ OK ] 18.45 sec.
2026-02-18 05:11:44 02267_output_format_prometheus: [ OK ] 0.93 sec.
2026-02-18 05:11:45 01088_benchmark_query_id: [ OK ] 3.24 sec.
2026-02-18 05:11:45 01009_global_array_join_names: [ OK ] 0.87 sec.
2026-02-18 05:11:46 00972_geohashesInBox: [ OK ] 1.90 sec.
2026-02-18 05:11:46 02480_analyzer_alias_nullptr: [ OK ] 0.73 sec.
2026-02-18 05:11:46 01230_join_get_truncate: [ OK ] 0.84 sec.
2026-02-18 05:11:47 00963_startsWith_force_primary_key: [ OK ] 0.95 sec.
2026-02-18 05:11:47 03208_array_of_json_read_subcolumns_1: [ OK ] 9.88 sec.
2026-02-18 05:11:47 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2026-02-18 05:11:47 Reason: not running for current build
2026-02-18 05:11:48 03156_group_concat: [ OK ] 1.60 sec.
2026-02-18 05:11:48 01946_profile_sleep: [ OK ] 3.34 sec.
2026-02-18 05:11:48 00351_select_distinct_arrays_tuples: [ OK ] 0.78 sec.
2026-02-18 05:11:49 02841_join_filter_set_sparse: [ OK ] 1.03 sec.
2026-02-18 05:11:49 00109_shard_totals_after_having: [ OK ] 2.45 sec.
2026-02-18 05:11:51 03038_nested_dynamic_merges_small: [ OK ] 3.64 sec.
2026-02-18 05:11:51 00957_delta_diff_bug: [ OK ] 0.68 sec.
2026-02-18 05:11:52 02993_lazy_index_loading: [ OK ] 3.19 sec.
2026-02-18 05:11:52 00195_shard_union_all_and_global_in: [ OK ] 0.88 sec.
2026-02-18 05:11:52 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 6.55 sec.
2026-02-18 05:11:53 02668_parse_datetime_in_joda_syntax: [ OK ] 3.19 sec.
2026-02-18 05:11:53 02813_float_parsing: [ OK ] 0.69 sec.
2026-02-18 05:11:53 02098_date32_comparison: [ OK ] 0.83 sec.
2026-02-18 05:11:53 02843_date_predicate_optimizations_bugs: [ OK ] 0.68 sec.
2026-02-18 05:11:54 02265_column_ttl: [ OK ] 1.64 sec.
2026-02-18 05:11:54 01881_to_week_monotonic_fix: [ OK ] 0.79 sec.
2026-02-18 05:11:54 02763_row_policy_storage_merge_alias: [ OK ] 1.08 sec.
2026-02-18 05:11:55 02354_numeric_literals_with_underscores: [ OK ] 0.63 sec.
2026-02-18 05:11:55 01776_decrypt_aead_size_check: [ OK ] 0.78 sec.
2026-02-18 05:11:56 01710_projection_with_column_transformers: [ OK ] 0.53 sec.
2026-02-18 05:11:56 01699_timezoneOffset: [ OK ] 1.28 sec.
2026-02-18 05:11:56 02115_map_contains_analyzer: [ OK ] 0.63 sec.
2026-02-18 05:11:57 00550_join_insert_select: [ OK ] 2.73 sec.
2026-02-18 05:11:57 02458_key_condition_not_like_prefix: [ OK ] 0.93 sec.
2026-02-18 05:11:57 02581_share_big_sets_between_mutation_tasks: [ OK ] 17.00 sec.
2026-02-18 05:11:57 01825_type_json_7: [ OK ] 4.90 sec.
2026-02-18 05:11:58 02872_prewhere_filter: [ OK ] 0.73 sec.
2026-02-18 05:11:58 02346_read_in_order_fixed_prefix: [ OK ] 18.39 sec.
2026-02-18 05:11:58 00619_union_highlite: [ OK ] 0.78 sec.
2026-02-18 05:11:59 02372_now_in_block: [ OK ] 1.48 sec.
2026-02-18 05:11:59 02893_bad_sample_view: [ OK ] 0.73 sec.
2026-02-18 05:11:59 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.73 sec.
2026-02-18 05:12:00 01353_low_cardinality_join_types: [ OK ] 1.49 sec.
2026-02-18 05:12:00 01753_optimize_aggregation_in_order: [ OK ] 1.94 sec.
2026-02-18 05:12:00 02095_function_get_os_kernel_version: [ OK ] 0.73 sec.
2026-02-18 05:12:01 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.75 sec.
2026-02-18 05:12:01 00825_protobuf_format_splitted_nested: [ OK ] 4.69 sec.
2026-02-18 05:12:01 00210_insert_select_extremes_http: [ OK ] 1.29 sec.
2026-02-18 05:12:01 03164_adapting_parquet_reader_output_size: [ OK ] 2.19 sec.
2026-02-18 05:12:02 00483_reading_from_array_structure: [ OK ] 0.94 sec.
2026-02-18 05:12:02 01544_fromModifiedJulianDay: [ OK ] 1.08 sec.
2026-02-18 05:12:02 01592_length_map: [ OK ] 0.78 sec.
2026-02-18 05:12:02 03352_distinct_sorted_bug: [ OK ] 0.78 sec.
2026-02-18 05:12:03 02017_columns_with_dot: [ OK ] 0.93 sec.
2026-02-18 05:12:04 02146_mv_non_phys: [ OK ] 0.68 sec.
2026-02-18 05:12:04 02457_csv_parse_date_out_of_range: [ OK ] 4.15 sec.
2026-02-18 05:12:05 03172_http_content_encoding: [ OK ] 2.94 sec.
2026-02-18 05:12:05 01767_timezoneOf: [ OK ] 1.53 sec.
2026-02-18 05:12:05 00552_logical_functions_simple: [ OK ] 0.88 sec.
2026-02-18 05:12:06 01562_agg_null_for_empty_ahead: [ OK ] 1.03 sec.
2026-02-18 05:12:06 00943_mv_rename_without_inner_table: [ OK ] 0.88 sec.
2026-02-18 05:12:06 03036_reading_s3_archives: [ OK ] 1.98 sec.
2026-02-18 05:12:07 02680_illegal_type_of_filter_projection: [ OK ] 0.83 sec.
2026-02-18 05:12:08 02918_template_format_deadlock: [ OK ] 1.48 sec.
2026-02-18 05:12:08 01519_topK_distributed_parametrized: [ OK ] 0.88 sec.
2026-02-18 05:12:08 01903_correct_block_size_prediction_with_default: [ OK ] 23.71 sec.
2026-02-18 05:12:08 03148_async_queries_in_query_log_errors: [ OK ] 5.95 sec.
2026-02-18 05:12:09 02562_with_fill_nullable: [ OK ] 0.73 sec.
2026-02-18 05:12:09 01662_date_ubsan: [ OK ] 1.28 sec.
2026-02-18 05:12:10 03148_asof_join_ddb_subquery: [ OK ] 0.78 sec.
2026-02-18 05:12:12 02267_empty_arrays_read_reverse: [ OK ] 1.68 sec.
2026-02-18 05:12:13 02984_form_format: [ OK ] 4.75 sec.
2026-02-18 05:12:13 01055_prewhere_bugs: [ OK ] 0.88 sec.
2026-02-18 05:12:13 00315_quantile_off_by_one: [ OK ] 0.78 sec.
2026-02-18 05:12:14 01017_bithamming_distance: [ OK ] 0.92 sec.
2026-02-18 05:12:14 01666_merge_tree_max_query_limit: [ OK ] 12.27 sec.
2026-02-18 05:12:15 01050_engine_join_view_crash: [ OK ] 0.88 sec.
2026-02-18 05:12:15 00751_low_cardinality_nullable_group_by: [ OK ] 1.68 sec.
2026-02-18 05:12:16 02507_to_unix_timestamp_overflow: [ OK ] 0.73 sec.
2026-02-18 05:12:17 00271_agg_state_and_totals: [ OK ] 0.73 sec.
2026-02-18 05:12:17 01520_client_print_query_id: [ OK ] 1.98 sec.
2026-02-18 05:12:17 01300_group_by_other_keys_having: [ OK ] 2.53 sec.
2026-02-18 05:12:17 02479_if_with_null_and_cullable_const: [ OK ] 0.73 sec.
2026-02-18 05:12:18 00947_ml_test: [ OK ] 0.98 sec.
2026-02-18 05:12:18 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 1.18 sec.
2026-02-18 05:12:19 02883_array_scalar_mult_div_modulo: [ OK ] 1.03 sec.
2026-02-18 05:12:19 03047_analyzer_alias_join: [ OK ] 0.68 sec.
2026-02-18 05:12:19 00045_sorting_by_fixed_string_descending: [ OK ] 0.78 sec.
2026-02-18 05:12:20 03168_query_log_privileges_not_empty: [ OK ] 11.21 sec.
2026-02-18 05:12:20 02366_kql_tabular: [ OK ] 1.53 sec.
2026-02-18 05:12:20 01115_prewhere_array_join: [ OK ] 1.59 sec.
2026-02-18 05:12:21 01773_min_max_time_system_parts_datetime64: [ OK ] 0.83 sec.
2026-02-18 05:12:22 02026_accurate_cast_or_default: [ OK ] 1.43 sec.
2026-02-18 05:12:22 02003_memory_limit_in_client: [ OK ] 15.33 sec.
2026-02-18 05:12:22 02577_keepermap_delete_update: [ OK ] 1.13 sec.
2026-02-18 05:12:22 02864_statistics_ddl: [ OK ] 3.39 sec.
2026-02-18 05:12:23 02100_multiple_hosts_command_line_set_ssl: [ OK ] 34.28 sec.
2026-02-18 05:12:23 02834_formats_with_variable_number_of_columns: [ OK ] 0.93 sec.
2026-02-18 05:12:23 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.78 sec.
2026-02-18 05:12:23 02982_create_mv_inner_extra: [ OK ] 0.70 sec.
2026-02-18 05:12:23 02422_insert_different_granularity: [ OK ] 1.53 sec.
2026-02-18 05:12:24 00568_empty_function_with_fixed_string: [ OK ] 0.73 sec.
2026-02-18 05:12:24 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2026-02-18 05:12:24 Reason: not running for current build
2026-02-18 05:12:24 01100_split_by_string: [ OK ] 0.73 sec.
2026-02-18 05:12:24 02787_transform_null: [ OK ] 0.67 sec.
2026-02-18 05:12:24 02711_trim_aliases: [ OK ] 0.68 sec.
2026-02-18 05:12:24 02474_extract_fixedstring_from_json: [ OK ] 0.83 sec.
2026-02-18 05:12:25 00310_tskv: [ OK ] 4.39 sec.
2026-02-18 05:12:25 02343_group_by_use_nulls: [ OK ] 1.18 sec.
2026-02-18 05:12:25 00239_type_conversion_in_in: [ OK ] 0.83 sec.
2026-02-18 05:12:26 03205_json_syntax: [ OK ] 1.08 sec.
2026-02-18 05:12:26 02944_variant_as_common_type_analyzer: [ OK ] 1.43 sec.
2026-02-18 05:12:27 00652_mutations_alter_update: [ OK ] 29.12 sec.
2026-02-18 05:12:27 01483_merge_table_join_and_group_by: [ OK ] 1.14 sec.
2026-02-18 05:12:27 02806_cte_block_cannot_be_empty: [ OK ] 0.73 sec.
2026-02-18 05:12:27 01293_show_settings: [ OK ] 0.32 sec.
2026-02-18 05:12:28 01268_mergine_sorted_limit: [ OK ] 0.88 sec.
2026-02-18 05:12:28 02015_async_inserts_2: [ OK ] 2.19 sec.
2026-02-18 05:12:28 02495_concat_with_separator: [ OK ] 1.63 sec.
2026-02-18 05:12:28 01017_uniqCombined_memory_usage: [ OK ] 1.68 sec.
2026-02-18 05:12:29 00882_multiple_join_no_alias: [ OK ] 0.93 sec.
2026-02-18 05:12:29 00800_versatile_storage_join: [ OK ] 1.23 sec.
2026-02-18 05:12:29 03167_empty_tuple_concat: [ OK ] 0.83 sec.
2026-02-18 05:12:29 01633_limit_fuzz: [ OK ] 0.68 sec.
2026-02-18 05:12:30 00937_format_schema_rows_template: [ OK ] 6.80 sec.
2026-02-18 05:12:30 03237_max_map_state_decimal_serialization: [ OK ] 0.73 sec.
2026-02-18 05:12:30 02991_count_rewrite_analyzer: [ OK ] 0.78 sec.
2026-02-18 05:12:30 01593_insert_settings: [ OK ] 1.18 sec.
2026-02-18 05:12:31 01926_date_date_time_supertype: [ OK ] 0.88 sec.
2026-02-18 05:12:31 01528_to_uuid_or_null_or_zero: [ OK ] 1.08 sec.
2026-02-18 05:12:31 01940_custom_tld_sharding_key: [ OK ] 0.89 sec.
2026-02-18 05:12:31 01497_now_support_timezone: [ OK ] 0.68 sec.
2026-02-18 05:12:32 02141_clickhouse_local_interactive_table: [ OK ] 1.83 sec.
2026-02-18 05:12:32 01507_transform_null_in: [ OK ] 0.73 sec.
2026-02-18 05:12:32 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 1.03 sec.
2026-02-18 05:12:33 01523_interval_operator_support_string_literal: [ OK ] 0.93 sec.
2026-02-18 05:12:33 02370_lost_part_intersecting_merges: [ OK ] 24.67 sec.
2026-02-18 05:12:33 01413_truncate_without_table_keyword: [ OK ] 0.63 sec.
2026-02-18 05:12:33 03198_settings_in_csv_tsv_schema_cache: [ OK ] 2.29 sec.
2026-02-18 05:12:33 01470_test_insert_select_asterisk: [ OK ] 0.88 sec.
2026-02-18 05:12:34 00148_summing_merge_tree_aggregate_function: [ OK ] 4.44 sec.
2026-02-18 05:12:34 01475_read_subcolumns_3: [ OK ] 1.08 sec.
2026-02-18 05:12:34 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.83 sec.
2026-02-18 05:12:34 01942_dateTimeToSnowflakeID: [ OK ] 1.08 sec.
2026-02-18 05:12:34 00834_not_between: [ OK ] 0.68 sec.
2026-02-18 05:12:35 00064_negate_bug: [ OK ] 0.67 sec.
2026-02-18 05:12:35 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.83 sec.
2026-02-18 05:12:35 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.88 sec.
2026-02-18 05:12:35 02711_server_uuid_macro: [ OK ] 0.88 sec.
2026-02-18 05:12:36 01881_join_on_conditions_merge: [ OK ] 2.49 sec.
2026-02-18 05:12:36 01476_right_full_join_switch: [ OK ] 1.03 sec.
2026-02-18 05:12:36 01042_check_query_and_last_granule_size: [ OK ] 1.03 sec.
2026-02-18 05:12:36 03213_rand_dos: [ OK ] 0.78 sec.
2026-02-18 05:12:37 02974_backup_query_format_null: [ OK ] 3.81 sec.
2026-02-18 05:12:37 00725_join_on_bug_4: [ OK ] 0.78 sec.
2026-02-18 05:12:37 01440_big_int_exotic_casts: [ OK ] 1.43 sec.
2026-02-18 05:12:38 02025_nested_func_for_if_combinator: [ OK ] 1.08 sec.
2026-02-18 05:12:38 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.98 sec.
2026-02-18 05:12:39 02565_analyzer_limit_settings: [ OK ] 1.14 sec.
2026-02-18 05:12:39 01514_input_format_json_enum_as_number: [ OK ] 0.83 sec.
2026-02-18 05:12:39 02476_analyzer_join_with_unused_columns: [ OK ] 0.88 sec.
2026-02-18 05:12:39 00603_system_parts_nonexistent_database: [ OK ] 0.68 sec.
2026-02-18 05:12:40 00832_storage_file_lock: [ OK ] 0.96 sec.
2026-02-18 05:12:40 02950_parallel_replicas_used_count: [ OK ] 3.84 sec.
2026-02-18 05:12:41 00605_intersections_aggregate_functions: [ OK ] 0.89 sec.
2026-02-18 05:12:41 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.89 sec.
2026-02-18 05:12:41 01825_type_json_partitions: [ OK ] 0.84 sec.
2026-02-18 05:12:42 02032_short_circuit_least_greatest_bug: [ OK ] 0.78 sec.
2026-02-18 05:12:42 01785_parallel_formatting_memory: [ OK ] 3.64 sec.
2026-02-18 05:12:43 03130_convert_outer_join_to_inner_join: [ OK ] 1.08 sec.
2026-02-18 05:12:43 01276_random_string: [ OK ] 3.14 sec.
2026-02-18 05:12:43 01345_array_join_LittleMaverick: [ OK ] 0.88 sec.
2026-02-18 05:12:43 02046_low_cardinality_parallel_group_by: [ OK ] 8.13 sec.
2026-02-18 05:12:43 00999_settings_no_extra_quotes: [ OK ] 0.73 sec.
2026-02-18 05:12:43 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.83 sec.
2026-02-18 05:12:44 03131_deprecated_functions: [ OK ] 0.93 sec.
2026-02-18 05:12:44 01783_parallel_formatting_memory: [ OK ] 1.59 sec.
2026-02-18 05:12:44 02340_analyzer_functions: [ OK ] 0.88 sec.
2026-02-18 05:12:44 01118_is_constant: [ OK ] 0.78 sec.
2026-02-18 05:12:44 00534_functions_bad_arguments12: [ SKIPPED ] 0.00 sec.
2026-02-18 05:12:44 Reason: not running for current build
2026-02-18 05:12:44 02024_compression_in_query: [ OK ] 8.56 sec.
2026-02-18 05:12:45 00757_enum_defaults_const_analyzer: [ OK ] 0.73 sec.
2026-02-18 05:12:45 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.67 sec.
2026-02-18 05:12:45 00753_alter_attach: [ OK ] 2.53 sec.
2026-02-18 05:12:45 02798_explain_settings_not_applied_bug: [ OK ] 0.83 sec.
2026-02-18 05:12:45 02746_index_analysis_binary_operator_with_null: [ OK ] 0.78 sec.
2026-02-18 05:12:45 03111_inner_join_group_by: [ OK ] 0.78 sec.
2026-02-18 05:12:46 02941_variant_type_2: [ OK ] 21.94 sec.
2026-02-18 05:12:46 01505_trivial_count_with_partition_predicate: [ OK ] 1.23 sec.
2026-02-18 05:12:46 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.62 sec.
2026-02-18 05:12:46 01768_extended_range: [ OK ] 0.68 sec.
2026-02-18 05:12:46 00322_disable_checksumming: [ OK ] 1.23 sec.
2026-02-18 05:12:46 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.73 sec.
2026-02-18 05:12:46 03269_partition_key_not_in_set: [ OK ] 1.43 sec.
2026-02-18 05:12:46 02564_read_in_order_final_desc: [ OK ] 0.83 sec.
2026-02-18 05:12:46 01932_global_in_function: [ OK ] 0.68 sec.
2026-02-18 05:12:47 02012_zookeeper_changed_enum_type: [ OK ] 0.89 sec.
2026-02-18 05:12:47 02366_kql_summarize: [ OK ] 1.48 sec.
2026-02-18 05:12:48 01418_index_analysis_bug: [ OK ] 0.88 sec.
2026-02-18 05:12:48 01825_new_type_json_9: [ OK ] 0.78 sec.
2026-02-18 05:12:48 02932_punycode: [ OK ] 1.53 sec.
2026-02-18 05:12:48 01281_parseDateTime64BestEffort: [ OK ] 1.43 sec.
2026-02-18 05:12:49 03015_peder1001: [ OK ] 0.84 sec.
2026-02-18 05:12:49 01457_order_by_nulls_first: [ OK ] 1.08 sec.
2026-02-18 05:12:49 00240_replace_substring_loop: [ OK ] 2.38 sec.
2026-02-18 05:12:49 00313_const_totals_extremes: [ OK ] 1.48 sec.
2026-02-18 05:12:49 02802_clickhouse_disks_s3_copy: [ OK ] 2.99 sec.
2026-02-18 05:12:49 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.73 sec.
2026-02-18 05:12:50 01750_parsing_exception: [ OK ] 1.93 sec.
2026-02-18 05:12:50 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.93 sec.
2026-02-18 05:12:50 02532_send_logs_level_test: [ SKIPPED ] 0.00 sec.
2026-02-18 05:12:50 Reason: not running for current build
2026-02-18 05:12:50 01480_binary_operator_monotonicity: [ OK ] 1.33 sec.
2026-02-18 05:12:50 00752_low_cardinality_permute: [ OK ] 0.77 sec.
2026-02-18 05:12:51 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 1.16 sec.
2026-02-18 05:12:51 01419_merge_tree_settings_sanity_check: [ OK ] 0.93 sec.
2026-02-18 05:12:51 03164_analyzer_validate_tree_size: [ OK ] 1.13 sec.
2026-02-18 05:12:52 01601_proxy_protocol: [ OK ] 1.28 sec.
2026-02-18 05:12:52 01685_json_extract_double_as_float: [ OK ] 0.93 sec.
2026-02-18 05:12:52 00613_shard_distributed_max_execution_time: [ OK ] 0.83 sec.
2026-02-18 05:12:52 02498_random_string_in_json_schema_inference: [ OK ] 1.53 sec.
2026-02-18 05:12:52 00299_stripe_log_multiple_inserts: [ OK ] 0.98 sec.
2026-02-18 05:12:53 01710_projection_optimize_group_by_function_keys: [ OK ] 1.03 sec.
2026-02-18 05:12:53 02043_user_defined_executable_function_implicit_cast: [ OK ] 1.48 sec.
2026-02-18 05:12:53 00853_join_with_nulls_crash: [ OK ] 1.64 sec.
2026-02-18 05:12:54 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.68 sec.
2026-02-18 05:12:54 01813_quantileBfloat16_nans: [ OK ] 0.72 sec.
2026-02-18 05:12:55 02466_distributed_query_profiler: [ OK ] 1.53 sec.
2026-02-18 05:12:55 00753_comment_columns_zookeeper: [ OK ] 0.63 sec.
2026-02-18 05:12:55 03053_analyzer_join_alias: [ OK ] 0.74 sec.
2026-02-18 05:12:56 00098_g_union_all: [ OK ] 0.73 sec.
2026-02-18 05:12:56 01104_fixed_string_like: [ OK ] 1.08 sec.
2026-02-18 05:12:57 02267_join_dup_columns_issue36199: [ OK ] 1.13 sec.
2026-02-18 05:12:57 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.59 sec.
2026-02-18 05:12:58 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.67 sec.
2026-02-18 05:12:58 03143_cte_scope: [ OK ] 0.73 sec.
2026-02-18 05:12:58 02420_stracktrace_debug_symbols: [ OK ] 1.68 sec.
2026-02-18 05:12:58 02995_index_5: [ SKIPPED ] 0.00 sec.
2026-02-18 05:12:58 Reason: not running for current build
2026-02-18 05:12:58 00033_fixed_string_to_string: [ OK ] 0.63 sec.
2026-02-18 05:12:59 02476_analyzer_identifier_hints: [ OK ] 34.45 sec.
2026-02-18 05:12:59 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.63 sec.
2026-02-18 05:12:59 02366_kql_mvexpand: [ OK ] 0.88 sec.
2026-02-18 05:13:00 02789_jit_cannot_convert_column: [ OK ] 0.68 sec.
2026-02-18 05:13:00 02234_position_case_insensitive_utf8: [ OK ] 0.73 sec.
2026-02-18 05:13:01 02430_initialize_aggregation_with_combinators: [ OK ] 0.88 sec.
2026-02-18 05:13:01 02165_h3_num_hexagons: [ OK ] 1.03 sec.
2026-02-18 05:13:02 01084_defaults_on_aliases: [ OK ] 0.98 sec.
2026-02-18 05:13:02 02149_schema_inference_create_table_syntax: [ OK ] 12.92 sec.
2026-02-18 05:13:02 01274_generate_random_nested: [ OK ] 1.23 sec.
2026-02-18 05:13:03 02812_subquery_operators: [ OK ] 0.78 sec.
2026-02-18 05:13:03 01681_bloom_filter_nullable_column: [ OK ] 1.13 sec.
2026-02-18 05:13:04 00517_date_parsing: [ OK ] 1.13 sec.
2026-02-18 05:13:04 03003_count_asterisk_filter: [ OK ] 0.83 sec.
2026-02-18 05:13:04 01411_xor_itai_shirav: [ OK ] 0.78 sec.
2026-02-18 05:13:05 00453_top_k: [ OK ] 0.78 sec.
2026-02-18 05:13:05 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.78 sec.
2026-02-18 05:13:05 02456_bloom_filter_assert: [ OK ] 1.43 sec.
2026-02-18 05:13:06 01576_alter_low_cardinality_and_select: [ OK ] 7.35 sec.
2026-02-18 05:13:06 02009_array_join_partition: [ OK ] 0.83 sec.
2026-02-18 05:13:06 01944_insert_partition_by: [ OK ] 1.03 sec.
2026-02-18 05:13:06 01710_query_log_with_projection_info: [ OK ] 1.63 sec.
2026-02-18 05:13:06 00841_temporary_table_database: [ OK ] 0.73 sec.
2026-02-18 05:13:07 02353_partition_prune_nullable_key: [ OK ] 0.77 sec.
2026-02-18 05:13:07 02882_primary_key_index_in_function_different_types: [ OK ] 1.03 sec.
2026-02-18 05:13:07 00346_if_tuple: [ OK ] 0.88 sec.
2026-02-18 05:13:07 02039_group_by_with_totals_having: [ OK ] 0.72 sec.
2026-02-18 05:13:08 01425_default_value_of_type_name: [ OK ] 0.78 sec.
2026-02-18 05:13:08 00460_vertical_and_totals_extremes: [ OK ] 0.88 sec.
2026-02-18 05:13:10 02987_group_array_intersect: [ OK ] 2.53 sec.
2026-02-18 05:13:11 00909_ngram_distance: [ OK ] 2.68 sec.
2026-02-18 05:13:11 03169_time_virtual_column: [ OK ] 2.34 sec.
2026-02-18 05:13:11 02013_zlib_read_after_eof: [ OK ] 4.64 sec.
2026-02-18 05:13:12 00141_parse_timestamp_as_datetime: [ OK ] 0.78 sec.
2026-02-18 05:13:12 02183_dictionary_date_types: [ OK ] 1.58 sec.
2026-02-18 05:13:13 01917_prewhere_column_type: [ OK ] 0.88 sec.
2026-02-18 05:13:13 02703_max_local_read_bandwidth: [ OK ] 26.91 sec.
2026-02-18 05:13:14 03006_join_on_inequal_expression_2: [ OK ] 2.64 sec.
2026-02-18 05:13:14 00938_dataset_test: [ OK ] 0.83 sec.
2026-02-18 05:13:14 00926_adaptive_index_granularity_merge_tree: [ OK ] 2.73 sec.
2026-02-18 05:13:14 02815_fix_not_found_constants_col_in_block: [ OK ] 0.83 sec.
2026-02-18 05:13:14 02354_vector_search_default_granularity: [ OK ] 0.93 sec.
2026-02-18 05:13:15 00687_insert_into_mv: [ OK ] 0.93 sec.
2026-02-18 05:13:16 02017_bit_shift_left_for_string_integer: [ OK ] 1.73 sec.
2026-02-18 05:13:16 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 1.78 sec.
2026-02-18 05:13:16 00553_buff_exists_materlized_column: [ OK ] 0.88 sec.
2026-02-18 05:13:16 00102_insert_into_temporary_table: [ OK ] 0.68 sec.
2026-02-18 05:13:18 01355_CSV_input_format_allow_errors: [ OK ] 3.59 sec.
2026-02-18 05:13:19 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.68 sec.
2026-02-18 05:13:19 02817_structure_to_schema: [ OK ] 21.35 sec.
2026-02-18 05:13:20 02870_per_column_settings: [ OK ] 1.14 sec.
2026-02-18 05:13:20 02477_s3_request_throttler: [ OK ] 3.79 sec.
2026-02-18 05:13:22 01825_type_json_ghdata: [ OK ] 12.18 sec.
2026-02-18 05:13:22 00908_long_http_insert: [ OK ] 2.33 sec.
2026-02-18 05:13:23 02902_add_scalar_in_all_case: [ OK ] 0.79 sec.
2026-02-18 05:13:24 02482_insert_into_dist_race: [ OK ] 0.88 sec.
2026-02-18 05:13:24 02710_protobuf_ipv4_date32: [ OK ] 2.24 sec.
2026-02-18 05:13:24 01825_type_json_from_map: [ OK ] 4.42 sec.
2026-02-18 05:13:25 02271_replace_partition_many_tables: [ OK ] 31.25 sec.
2026-02-18 05:13:25
2026-02-18 05:13:25 Having 1 errors! 344 tests passed. 5 tests skipped. 1233.04 s elapsed (Process-3).
2026-02-18 05:13:25 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 8.50 sec.
2026-02-18 05:13:25
2026-02-18 05:13:25 388 tests passed. 5 tests skipped. 1233.04 s elapsed (Process-7).
2026-02-18 05:13:25 02764_csv_trim_whitespaces: [ OK ] 32.89 sec.
2026-02-18 05:13:25
2026-02-18 05:13:25 414 tests passed. 7 tests skipped. 1233.10 s elapsed (Process-4).
2026-02-18 05:13:25 00462_json_true_false_literals: [ OK ] 0.83 sec.
2026-02-18 05:13:25
2026-02-18 05:13:25 421 tests passed. 2 tests skipped. 1233.33 s elapsed (Process-6).
2026-02-18 05:13:26 01676_range_hashed_dictionary: [ OK ] 1.48 sec.
2026-02-18 05:13:26
2026-02-18 05:13:26 Having 1 errors! 340 tests passed. 4 tests skipped. 1234.16 s elapsed (Process-10).
2026-02-18 05:13:26 02421_new_type_json_async_insert: [ OK ] 6.56 sec.
2026-02-18 05:13:26
2026-02-18 05:13:26 366 tests passed. 4 tests skipped. 1234.21 s elapsed (Process-8).
2026-02-18 05:13:26 02899_distributed_limit_by: [ OK ] 1.83 sec.
2026-02-18 05:13:26
2026-02-18 05:13:26 493 tests passed. 10 tests skipped. 1234.71 s elapsed (Process-5).
2026-02-18 05:13:41 02500_remove_redundant_distinct_analyzer: [ OK ] 24.63 sec.
2026-02-18 05:13:41
2026-02-18 05:13:41 445 tests passed. 4 tests skipped. 1249.41 s elapsed (Process-9).
2026-02-18 05:13:50 Running 282 stateless tests (MainProcess).
2026-02-18 05:13:58 03231_restore_user_with_existing_role: [ OK ] 7.66 sec.
2026-02-18 05:14:04 03206_replication_lag_metric: [ OK ] 5.75 sec.
2026-02-18 05:14:04 03198_table_function_directory_path: [ OK ] 0.88 sec.
2026-02-18 05:14:05 03198_dynamic_read_subcolumns: [ OK ] 0.93 sec.
2026-02-18 05:14:06 03168_loop_engine_with_parallel_replicas: [ OK ] 0.62 sec.
2026-02-18 05:14:10 03154_lazy_token_iterator: [ OK ] 3.44 sec.
2026-02-18 05:14:35 03151_unload_index_race: [ OK ] 25.42 sec.
2026-02-18 05:14:35 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec.
2026-02-18 05:14:35 Reason: not running for current build
2026-02-18 05:14:37 03147_parquet_memory_tracking: [ OK ] 1.58 sec.
2026-02-18 05:14:38 03147_table_function_loop: [ OK ] 0.88 sec.
2026-02-18 05:16:29 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 111.07 sec.
2026-02-18 05:16:37 03008_s3_plain_rewritable_fault: [ OK ] 8.66 sec.
2026-02-18 05:18:04 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 86.44 sec.
2026-02-18 05:19:25 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 80.76 sec.
2026-02-18 05:21:09 03008_deduplication_insert_several_blocks_replicated: [ OK ] 104.10 sec.
2026-02-18 05:21:14 03002_part_log_rmt_fetch_merge_error: [ OK ] 5.45 sec.
2026-02-18 05:21:24 03002_part_log_rmt_fetch_mutate_error: [ OK ] 10.07 sec.
2026-02-18 05:21:25 02990_rmt_replica_path_uuid: [ OK ] 0.99 sec.
2026-02-18 05:21:32 02980_dist_insert_readonly_replica: [ OK ] 6.56 sec.
2026-02-18 05:21:36 02973_backup_of_in_memory_compressed: [ OK ] 4.14 sec.
2026-02-18 05:22:36 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 59.31 sec.
2026-02-18 05:22:37 02961_drop_tables: [ OK ] 1.08 sec.
2026-02-18 05:22:38 02960_partition_by_udf: [ OK ] 0.88 sec.
2026-02-18 05:22:46 02944_dynamically_change_filesystem_cache_size: [ OK ] 8.01 sec.
2026-02-18 05:22:54 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 8.26 sec.
2026-02-18 05:22:56 02931_max_num_to_warn: [ OK ] 1.23 sec.
2026-02-18 05:23:00 02916_move_partition_inactive_replica: [ OK ] 4.90 sec.
2026-02-18 05:23:05 02915_move_partition_inactive_replica: [ OK ] 4.39 sec.
2026-02-18 05:23:06 02911_row_policy_on_cluster: [ OK ] 0.94 sec.
2026-02-18 05:23:06 02910_prefetch_unexpceted_exception: [ OK ] 0.43 sec.
2026-02-18 05:23:07 02908_empty_named_collection: [ OK ] 0.63 sec.
2026-02-18 05:23:15 02908_many_requests_to_system_replicas: [ OK ] 7.06 sec.
2026-02-18 05:23:22 02888_replicated_merge_tree_creation: [ OK ] 7.20 sec.
2026-02-18 05:23:23 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.98 sec.
2026-02-18 05:23:25 02884_async_insert_skip_settings: [ OK ] 1.43 sec.
2026-02-18 05:23:30 02884_async_insert_native_protocol_3: [ OK ] 4.99 sec.
2026-02-18 05:23:53 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 23.58 sec.
2026-02-18 05:24:13 02871_peak_threads_usage: [ OK ] 19.70 sec.
2026-02-18 05:24:14 02867_create_user_ssh: [ OK ] 0.79 sec.
2026-02-18 05:24:15 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.94 sec.
2026-02-18 05:24:19 02845_threads_count_in_distributed_queries: [ OK ] 4.40 sec.
2026-02-18 05:24:21 02843_insertion_table_schema_infer: [ OK ] 1.33 sec.
2026-02-18 05:24:28 02841_parquet_filter_pushdown: [ OK ] 6.80 sec.
2026-02-18 05:24:29 02833_multiprewhere_extra_column: [ OK ] 0.88 sec.
2026-02-18 05:24:34 02808_filesystem_cache_drop_query: [ OK ] 5.15 sec.
2026-02-18 05:24:36 02796_calculate_text_stack_trace: [ OK ] 2.34 sec.
2026-02-18 05:24:43 02789_filesystem_cache_alignment: [ OK ] 7.00 sec.
2026-02-18 05:24:46 02789_table_functions_errors: [ OK ] 2.84 sec.
2026-02-18 05:24:46 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec.
2026-02-18 05:24:46 Reason: not running for current build
2026-02-18 05:24:48 02775_show_columns_called_from_mysql: [ OK ] 1.49 sec.
2026-02-18 05:24:48 02762_replicated_database_no_args: [ OK ] 0.53 sec.
2026-02-18 05:24:50 02751_ip_types_aggregate_functions_states: [ OK ] 1.84 sec.
2026-02-18 05:24:53 02736_reading_and_writing_structure_fields: [ OK ] 2.69 sec.
2026-02-18 05:24:54 02735_capnp_case_insensitive_names_matching: [ OK ] 1.38 sec.
2026-02-18 05:25:09 02735_parquet_encoder: [ OK ] 14.34 sec.
2026-02-18 05:25:10 02725_url_support_virtual_column: [ OK ] 0.73 sec.
2026-02-18 05:25:43 02725_start_stop_fetches: [ OK ] 33.31 sec.
2026-02-18 05:25:44 02710_default_replicated_parameters: [ OK ] 0.68 sec.
2026-02-18 05:25:45 02706_show_columns: [ OK ] 1.69 sec.
2026-02-18 05:26:10 02700_s3_part_INT_MAX: [ OK ] 24.58 sec.
2026-02-18 05:26:10 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec.
2026-02-18 05:26:10 Reason: not running for current build
2026-02-18 05:26:12 02572_system_logs_materialized_views_ignore_errors: [ OK ] 1.84 sec.
2026-02-18 05:26:17 02566_ipv4_ipv6_binary_formats: [ OK ] 5.25 sec.
2026-02-18 05:26:19 02561_temporary_table_sessions: [ OK ] 1.44 sec.
2026-02-18 05:26:20 02541_arrow_duration_type: [ OK ] 1.54 sec.
2026-02-18 05:26:55 02535_max_parallel_replicas_custom_key_mt: [ OK ] 34.18 sec.
2026-02-18 05:27:29 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 34.77 sec.
2026-02-18 05:27:31 02522_avro_complicate_schema: [ OK ] 1.58 sec.
2026-02-18 05:28:33 02515_cleanup_async_insert_block_ids: [ OK ] 62.03 sec.
2026-02-18 05:28:35 02510_orc_map_indexes: [ OK ] 1.48 sec.
2026-02-18 05:28:38 02503_cache_on_write_with_small_segment_size: [ OK ] 3.04 sec.
2026-02-18 05:28:44 02503_insert_storage_snapshot: [ OK ] 5.90 sec.
2026-02-18 05:28:45 02501_deep_recusion_schema_inference: [ OK ] 1.79 sec.
2026-02-18 05:28:45 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec.
2026-02-18 05:28:45 Reason: not running for current build
2026-02-18 05:28:46 02495_s3_filter_by_file: [ OK ] 0.93 sec.
2026-02-18 05:28:47 02494_query_cache_user_quotas_after_drop: [ OK ] 0.68 sec.
2026-02-18 05:28:49 02494_query_cache_query_log: [ OK ] 2.24 sec.
2026-02-18 05:28:51 02494_query_cache_case_agnostic_matching: [ OK ] 1.08 sec.
2026-02-18 05:28:51 02494_query_cache_compression: [ OK ] 0.83 sec.
2026-02-18 05:28:52 02494_query_cache_totals_extremes: [ OK ] 0.93 sec.
2026-02-18 05:28:53 02494_query_cache_exception_handling: [ OK ] 0.63 sec.
2026-02-18 05:28:54 02494_query_cache_eligible_queries: [ OK ] 0.84 sec.
2026-02-18 05:29:01 02494_query_cache_ttl_long: [ OK ] 6.70 sec.
2026-02-18 05:29:02 02494_query_cache_events: [ OK ] 1.18 sec.
2026-02-18 05:29:07 02494_trace_log_profile_events: [ OK ] 5.40 sec.
2026-02-18 05:29:08 02494_query_cache_bugs: [ OK ] 0.83 sec.
2026-02-18 05:29:09 02494_query_cache_squash_partial_results: [ OK ] 0.93 sec.
2026-02-18 05:29:10 02484_substitute_udf_storage_args: [ OK ] 0.68 sec.
2026-02-18 05:29:11 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.63 sec.
2026-02-18 05:29:14 02483_capnp_decimals: [ OK ] 2.99 sec.
2026-02-18 05:29:15 02482_new_json_nested_arrays_with_same_keys: [ OK ] 1.33 sec.
2026-02-18 05:29:16 02482_json_nested_arrays_with_same_keys: [ OK ] 1.38 sec.
2026-02-18 05:29:19 02481_custom_separated_and_template_with_csv_field: [ OK ] 2.28 sec.
2026-02-18 05:29:22 02459_glob_for_recursive_directory_traversal: [ OK ] 3.45 sec.
2026-02-18 05:29:23 02458_hdfs_cluster_schema_inference: [ OK ] 0.93 sec.
2026-02-18 05:29:27 02440_mutations_finalization: [ OK ] 3.84 sec.
2026-02-18 05:29:28 02422_msgpack_uuid_wrong_column: [ OK ] 0.68 sec.
2026-02-18 05:29:33 02422_allow_implicit_no_password: [ OK ] 4.69 sec.
2026-02-18 05:29:42 02421_record_errors_row_by_input_format: [ OK ] 8.88 sec.
2026-02-18 05:29:42 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.58 sec.
2026-02-18 05:29:44 02404_schema_inference_cache_respect_format_settings: [ OK ] 1.64 sec.
2026-02-18 05:29:44 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec.
2026-02-18 05:29:44 Reason: disabled
2026-02-18 05:29:44 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2026-02-18 05:29:44 Reason: disabled
2026-02-18 05:29:45 02391_recursive_buffer: [ OK ] 0.93 sec.
2026-02-18 05:29:46 02385_profile_events_overflow: [ OK ] 0.98 sec.
2026-02-18 05:29:47 02376_arrow_dict_with_string: [ OK ] 0.63 sec.
2026-02-18 05:29:48 02373_heap_buffer_overflow_in_avro: [ OK ] 1.73 sec.
2026-02-18 05:29:48 02352_rwlock: [ SKIPPED ] 0.00 sec.
2026-02-18 05:29:48 Reason: not running for current build
2026-02-18 05:29:50 02350_views_max_insert_threads: [ OK ] 1.28 sec.
2026-02-18 05:29:50 02346_additional_filters_distr: [ OK ] 0.68 sec.
2026-02-18 05:29:54 02337_drop_filesystem_cache_access: [ OK ] 3.14 sec.
2026-02-18 05:29:54 02323_null_modifier_in_table_function: [ OK ] 0.63 sec.
2026-02-18 05:29:55 02313_avro_records_and_maps: [ OK ] 0.88 sec.
2026-02-18 05:29:57 02311_system_zookeeper_insert_priv: [ OK ] 1.68 sec.
2026-02-18 05:29:58 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.68 sec.
2026-02-18 05:30:11 02294_overcommit_overflow: [ OK ] 13.40 sec.
2026-02-18 05:31:04 02286_mysql_dump_input_format: [ OK ] 53.10 sec.
2026-02-18 05:31:08 02262_column_ttl: [ OK ] 4.14 sec.
2026-02-18 05:31:24 02247_written_bytes_quota: [ OK ] 15.80 sec.
2026-02-18 05:31:25 02244_lowcardinality_hash_join: [ OK ] 0.78 sec.
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/ljcundermojewshwsxaxjieudfvncnhe HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/mdyfjflyonvlnqjmwrrmhacpbqtqkqia HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/csoxaqapztweoovtonxbessviayaeobn HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/cfiykdwfxdzzrwhfsczwybtqpuephest HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/xpaecqathuphsysjyumihxopitvulilp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/fpzrjsedwjjrivfrafaisssegvfjjolh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/pzdpeikckgrmqpjegdstgqimvucpgmmd HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/xjdjharhrgavkovelmxgaekmugvtaymj HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/whhwetxznhspnzqtnmxelzncutqqpxnk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "PUT /devstoreaccount1/cont/akbrkmnofsbaquvkqogtfhvzndfrkvrp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "GET /devstoreaccount1/cont/csoxaqapztweoovtonxbessviayaeobn HTTP/1.1" 206 520
127.0.0.1 - - [18/Feb/2026:05:31:34 +0000] "GET /devstoreaccount1/cont/mdyfjflyonvlnqjmwrrmhacpbqtqkqia HTTP/1.1" 206 808111
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/akbrkmnofsbaquvkqogtfhvzndfrkvrp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/pzdpeikckgrmqpjegdstgqimvucpgmmd HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/xpaecqathuphsysjyumihxopitvulilp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/mdyfjflyonvlnqjmwrrmhacpbqtqkqia HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/csoxaqapztweoovtonxbessviayaeobn HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/cfiykdwfxdzzrwhfsczwybtqpuephest HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/fpzrjsedwjjrivfrafaisssegvfjjolh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/whhwetxznhspnzqtnmxelzncutqqpxnk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/xjdjharhrgavkovelmxgaekmugvtaymj HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:31:37 +0000] "DELETE /devstoreaccount1/cont/ljcundermojewshwsxaxjieudfvncnhe HTTP/1.1" 202 -
2026-02-18 05:31:37 02242_system_filesystem_cache_log_table: [ OK ] 11.57 sec.
2026-02-18 05:31:49 02242_delete_user_race: [ OK ] 12.63 sec.
127.0.0.1 - - [18/Feb/2026:05:32:13 +0000] "PUT /devstoreaccount1/cont/vfrfjpxegpxqmqsejsipbaqozqvjorcy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/arzvyrgvtafrwcjpmnjteybtmvmksczy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/omwmyulwimseyumhbsnjlrmgzslgyeny HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/jzfzqpjfzhafjrcukxpgpzpyityqkldr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/zqfedjnjliljviplvyclavnrzbcnjfbg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/djcwsewlttndcuwdsdhlkhotyntzlplx HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/fnzefxaeoginlakggbgduyaourduhbdm HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/cxfccgruyiupcuppunbmatdppalkkzuo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:15 +0000] "PUT /devstoreaccount1/cont/jfxmlraebrlaqjubslniynmzcefjleqf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/xdcumzjgftlkniardmvzwojccsvidpov HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/emzgomqzkzqepwdhmxeoijpuxqutqgxn HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/wfsputajmpjmxefbeuxgrdzbpylpjddn HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/cqgohktwdmwekeebbisvcipikpuifort HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/chdkgueeveeolfmtiuzdhdfzvoswinqt HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/tplwhzcrtlxmfblstwdcazvzgiafpfqh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/vkooqauxydyqzcwsqaetqkggndcyiiwz HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:18 +0000] "PUT /devstoreaccount1/cont/sgrdsrpmquikaxrhczshmcrzxsvfurqk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/ypdjowyedktwttwvekqktxvjgoxxnhyo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/enddfraphvjmvjfhsscznnpmkgccykdw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/kjqeotroebnznnebcszlmmoxqmxdfzqq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/xmeuminqrhrilckxivpbzpvnnsfgjoqc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/tsyafufmwrfdrxmddnsaammlbgnodgld HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/rtudsfbnejmnrjufgifdcdnetzljkqiv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/icrcjpvmeqkzrlupstlnhnphdbxtxheg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/ebgmoyhepvdttableikhnzglgvqkqsuj HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/idzojmbslqyqbtwtgjreabouhtxpucio HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/jsrnxtntysgpjrbnoefwtulmvotrvktq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/owowvvcpmibxmnfpuwsgyoujbbsxmtda HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/fjdsveihtxugrwzrjxkeincdbunxtynr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/xqomvmmejnhutzgicuphtiwvrfcmivte HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/haeogiygxlgvxkkazxzppoukpdytfsbd HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/bgwdljfclzoeiflacqcjplfqdhfikjyh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/lmtfwyyrcavdtjgbcxizmxaevjzvzrvt HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/dseyrcspgsxxqhnbsoqrwtwutuqktyjv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/tishhkylpysxhnkogdxehvhrpsgcwoyy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:20 +0000] "PUT /devstoreaccount1/cont/shyjjmtdlxvymwlrnpnnxonxfxnyqmiv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/rljjubjoremnanqvydbpmbyxqbvzpgvi HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/xvxhuepqrzvloewhwbblvbawffhngzpa HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/waalfvxbfirkrkifpvjrtabejznpehzb HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/dothpwoncuwtnoxmthipheqcfvkiaeju HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/hgwygaexkchzenuhbesyofwvmbqgxcsy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "GET /devstoreaccount1/cont/enddfraphvjmvjfhsscznnpmkgccykdw HTTP/1.1" 206 80
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "GET /devstoreaccount1/cont/arzvyrgvtafrwcjpmnjteybtmvmksczy HTTP/1.1" 206 746
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "GET /devstoreaccount1/cont/ypdjowyedktwttwvekqktxvjgoxxnhyo HTTP/1.1" 206 746
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/qxoupxpqboghplmkirxfwkeptpjndruk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/fmumsvldermzrwwaqzfnbzenjmubplqo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/hrbfevbmrvtcjwixqyevuudzvinfapkh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/qjrjwhamzomjeigryztynbplatnxwyyr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/jwiczcjnszpzwwawrhygmcupzgpwhckd HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/gdmxcyfiqtawzjrplqzipvpegnbdfccc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/uxctglzfbcuuftvipgummzuogjwhlzrz HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:21 +0000] "PUT /devstoreaccount1/cont/fggouiqhrfrqvknghxvikspxfnmhqezt HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/owzqkjjcbtoszzqoqlgzgazitaguswue HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/nncpsbuyrdwtvnfuwrhyktxqsimggecv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/vgcooteadmunhobneuyjelctdnrjreag HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ztukhxyybfsrqynsslfzqlmxjanfhjko HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/aossydwdqrdswchrfipdswnawvflmasy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/buuegrgxbcotpbokwdgiiupovppgnhfy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/rfjbqrvzqwfvawryumxkpkjewrxysuys HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ndapzwoevxgacbiamlbqktrvfywdszhf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ttfaubacgghsdxmcoajdcdtlurtdysdp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/qlcqbkjfrqhenewipldkxlalozdxncil HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/jeaauiddagornukcguaesdfgixdjdqnc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/vmmvwefshhlewevqmvtlslvcibvciljw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/zrmqyhjjovhorcqcujfjsbkdhrrxmsad HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/inxcvkylgqsuoyiljypmsnvgcmvpacph HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ikrrlygcspptiwclrhhqpyhwshkrwvby HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/mryttotumctpvpiklssoyddawpuuvved HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ljfkpimwgujmsaqgegzbpmdfjhozvpnq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/ijgvkbpevrjxzvvprqheicijpvuhnaen HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:22 +0000] "PUT /devstoreaccount1/cont/bqsrpxwykvhsrhorcxfmmtzdgsuxrvfl HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/hsutrjumpmsvpvoddsgmynxbdqkoqonf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/przethxsiluxhykgvwviwwbxzpvfjdvg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/nmggbnwawywqkididkplnlmfrrfyiohf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/qtnqtbblafhvfsxvzeyfwimfrvsxndrr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/vuzmcqcsqfdwebfvsprqhleezcffwmys HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/btesrtjyeoqyvsxbjimlfnslovspefgt HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/sfbexqoluwijvwpjnvwvnarrywtaaipp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/ifffuktejowuztsbfufnnsotwwlnwgqo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/ejpkoxvsdyqcjpcgrgesyunpehbhrgzg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/snbpaxkltfhstfpqlacltlnbnlycwrqf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/paqmbdpdaqdvjmjfogxirnmamydflghb HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/sydjgitpwyipyogmokayshbqapkfqyjh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/btrwobtxabozzjodterudckodemlcaxp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/ztgpmhjqsscaszuemsmdfxwojgzdcwls HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/kjvfirqallnveuscbgaqknquyeszzkwu HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/hrvuyoilchcnrcytljstlcytlugdvgvf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/blklwlccdaaxobezfvugeaijkxuiyphv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/yhemgwqbdtfxiictpwdlaxipfwotpcud HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/nhmvcwatytpzsfrhjzmoupwsimyhhvsq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:23 +0000] "PUT /devstoreaccount1/cont/mcoejhverpcnbkzxgmnitdxkjptagbfw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/lrkkejznxlnjyzredhnwfrpxckqxuzxp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/fwyqsljhaoesexujqtjmjfvwaexjoycy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/unaadwizalgqskkkukbucvxufophwuty HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/plqdqympgnmfmdexrznsqhqeocuyiexw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/zvcpdmqipnydbpmpgvlyyfidcjvzndzh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/tdaoejuodblwtnoisxapombktebnwbsx HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/kqvlgsihxrtekodpyrwthyoygestzhkd HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/xcyaylpeujyfqhagtmpktarztsejbunx HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/dqlelwdaumyjcteplvnhsdmfgatpdvkk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/kypzujhmaecxuaxjhkmgtuayafbiyhmy HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/zovvofoudfenwlhjpshofeivhnfsvipp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/xxwypfrpsgljuiuevsqqfvpwfeertgzc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/cqlfhcedymwcxqzpzxpitbbbmtjceesq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/sbrsvndmfhbkxbhbwqulqyjrximeyqyf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/tnqxehdicqahvgjvxvvhzkzgjiugddpq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/vahuwbcbpldcraoutbgzwzyfqtnbvstr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/magtigzyljmewwobxpgrqqdkndxwlfsn HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/fkykzknipfuifsrxhchzqiosqwoxblcs HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/wgqljewcfwfsmgredjgkcfdrnuzlnajc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:24 +0000] "PUT /devstoreaccount1/cont/vhsoyxdfqaxvkilcqufqtqymuvrslubr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:25 +0000] "PUT /devstoreaccount1/cont/brqhfbsprwslzunfpxvkaotcfhyaoqgp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:25 +0000] "PUT /devstoreaccount1/cont/apvnrmnsnbqebidsxblnhlqxkowoflzv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/amgvnqysfkctrvzjhtkdrraiuwgdpxsc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/tiiqrlotvliltvdbeddkckyxcqriiost HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/kyazvqihaqzaclyepuxfnxiimhhxralh HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/sdrlyummjixvinvevlnikfpzvkggrjsp HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/vntweoxeqpcytnirnkngybfvwggwnckz HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/xsoeymdvntorhfodazxiyzrqecigamxx HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/ifooltwpdiwuhwtljzsajjplxwlwfwtf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "PUT /devstoreaccount1/cont/wljnvlvpbnjbhymsuprwgcxwylpkhffc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/wljnvlvpbnjbhymsuprwgcxwylpkhffc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/brqhfbsprwslzunfpxvkaotcfhyaoqgp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/sdrlyummjixvinvevlnikfpzvkggrjsp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/apvnrmnsnbqebidsxblnhlqxkowoflzv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vntweoxeqpcytnirnkngybfvwggwnckz HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/kyazvqihaqzaclyepuxfnxiimhhxralh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/amgvnqysfkctrvzjhtkdrraiuwgdpxsc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tiiqrlotvliltvdbeddkckyxcqriiost HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ifooltwpdiwuhwtljzsajjplxwlwfwtf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xsoeymdvntorhfodazxiyzrqecigamxx HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/jfxmlraebrlaqjubslniynmzcefjleqf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/djcwsewlttndcuwdsdhlkhotyntzlplx HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/zqfedjnjliljviplvyclavnrzbcnjfbg HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/arzvyrgvtafrwcjpmnjteybtmvmksczy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/omwmyulwimseyumhbsnjlrmgzslgyeny HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/jzfzqpjfzhafjrcukxpgpzpyityqkldr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/cxfccgruyiupcuppunbmatdppalkkzuo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fnzefxaeoginlakggbgduyaourduhbdm HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fggouiqhrfrqvknghxvikspxfnmhqezt HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/jwiczcjnszpzwwawrhygmcupzgpwhckd HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/qjrjwhamzomjeigryztynbplatnxwyyr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/qxoupxpqboghplmkirxfwkeptpjndruk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fmumsvldermzrwwaqzfnbzenjmubplqo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/hrbfevbmrvtcjwixqyevuudzvinfapkh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/uxctglzfbcuuftvipgummzuogjwhlzrz HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/gdmxcyfiqtawzjrplqzipvpegnbdfccc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ttfaubacgghsdxmcoajdcdtlurtdysdp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/buuegrgxbcotpbokwdgiiupovppgnhfy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/aossydwdqrdswchrfipdswnawvflmasy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/nncpsbuyrdwtvnfuwrhyktxqsimggecv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vgcooteadmunhobneuyjelctdnrjreag HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ztukhxyybfsrqynsslfzqlmxjanfhjko HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ndapzwoevxgacbiamlbqktrvfywdszhf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/rfjbqrvzqwfvawryumxkpkjewrxysuys HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/sgrdsrpmquikaxrhczshmcrzxsvfurqk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/chdkgueeveeolfmtiuzdhdfzvoswinqt HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/cqgohktwdmwekeebbisvcipikpuifort HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xdcumzjgftlkniardmvzwojccsvidpov HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/emzgomqzkzqepwdhmxeoijpuxqutqgxn HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/wfsputajmpjmxefbeuxgrdzbpylpjddn HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vkooqauxydyqzcwsqaetqkggndcyiiwz HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tplwhzcrtlxmfblstwdcazvzgiafpfqh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ebgmoyhepvdttableikhnzglgvqkqsuj HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tsyafufmwrfdrxmddnsaammlbgnodgld HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xmeuminqrhrilckxivpbzpvnnsfgjoqc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ypdjowyedktwttwvekqktxvjgoxxnhyo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/enddfraphvjmvjfhsscznnpmkgccykdw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/kjqeotroebnznnebcszlmmoxqmxdfzqq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/icrcjpvmeqkzrlupstlnhnphdbxtxheg HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/rtudsfbnejmnrjufgifdcdnetzljkqiv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/lmtfwyyrcavdtjgbcxizmxaevjzvzrvt HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xqomvmmejnhutzgicuphtiwvrfcmivte HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fjdsveihtxugrwzrjxkeincdbunxtynr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/idzojmbslqyqbtwtgjreabouhtxpucio HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/jsrnxtntysgpjrbnoefwtulmvotrvktq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/owowvvcpmibxmnfpuwsgyoujbbsxmtda HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/bgwdljfclzoeiflacqcjplfqdhfikjyh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/haeogiygxlgvxkkazxzppoukpdytfsbd HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/hgwygaexkchzenuhbesyofwvmbqgxcsy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xvxhuepqrzvloewhwbblvbawffhngzpa HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/rljjubjoremnanqvydbpmbyxqbvzpgvi HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/dseyrcspgsxxqhnbsoqrwtwutuqktyjv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tishhkylpysxhnkogdxehvhrpsgcwoyy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/shyjjmtdlxvymwlrnpnnxonxfxnyqmiv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/dothpwoncuwtnoxmthipheqcfvkiaeju HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/waalfvxbfirkrkifpvjrtabejznpehzb HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/bqsrpxwykvhsrhorcxfmmtzdgsuxrvfl HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/qlcqbkjfrqhenewipldkxlalozdxncil HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ikrrlygcspptiwclrhhqpyhwshkrwvby HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/jeaauiddagornukcguaesdfgixdjdqnc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/mryttotumctpvpiklssoyddawpuuvved HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/inxcvkylgqsuoyiljypmsnvgcmvpacph HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vmmvwefshhlewevqmvtlslvcibvciljw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/zrmqyhjjovhorcqcujfjsbkdhrrxmsad HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ijgvkbpevrjxzvvprqheicijpvuhnaen HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ljfkpimwgujmsaqgegzbpmdfjhozvpnq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/snbpaxkltfhstfpqlacltlnbnlycwrqf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/hsutrjumpmsvpvoddsgmynxbdqkoqonf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/btesrtjyeoqyvsxbjimlfnslovspefgt HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/przethxsiluxhykgvwviwwbxzpvfjdvg HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/sfbexqoluwijvwpjnvwvnarrywtaaipp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vuzmcqcsqfdwebfvsprqhleezcffwmys HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/nmggbnwawywqkididkplnlmfrrfyiohf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/qtnqtbblafhvfsxvzeyfwimfrvsxndrr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ejpkoxvsdyqcjpcgrgesyunpehbhrgzg HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ifffuktejowuztsbfufnnsotwwlnwgqo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/mcoejhverpcnbkzxgmnitdxkjptagbfw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/paqmbdpdaqdvjmjfogxirnmamydflghb HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/hrvuyoilchcnrcytljstlcytlugdvgvf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/sydjgitpwyipyogmokayshbqapkfqyjh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/blklwlccdaaxobezfvugeaijkxuiyphv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/kjvfirqallnveuscbgaqknquyeszzkwu HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/btrwobtxabozzjodterudckodemlcaxp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/ztgpmhjqsscaszuemsmdfxwojgzdcwls HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/nhmvcwatytpzsfrhjzmoupwsimyhhvsq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/yhemgwqbdtfxiictpwdlaxipfwotpcud HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/kypzujhmaecxuaxjhkmgtuayafbiyhmy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/lrkkejznxlnjyzredhnwfrpxckqxuzxp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tdaoejuodblwtnoisxapombktebnwbsx HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fwyqsljhaoesexujqtjmjfvwaexjoycy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/kqvlgsihxrtekodpyrwthyoygestzhkd HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/zvcpdmqipnydbpmpgvlyyfidcjvzndzh HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/unaadwizalgqskkkukbucvxufophwuty HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/plqdqympgnmfmdexrznsqhqeocuyiexw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/dqlelwdaumyjcteplvnhsdmfgatpdvkk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xcyaylpeujyfqhagtmpktarztsejbunx HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vhsoyxdfqaxvkilcqufqtqymuvrslubr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/zovvofoudfenwlhjpshofeivhnfsvipp HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vahuwbcbpldcraoutbgzwzyfqtnbvstr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/xxwypfrpsgljuiuevsqqfvpwfeertgzc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/magtigzyljmewwobxpgrqqdkndxwlfsn HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/tnqxehdicqahvgjvxvvhzkzgjiugddpq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/cqlfhcedymwcxqzpzxpitbbbmtjceesq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/sbrsvndmfhbkxbhbwqulqyjrximeyqyf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/wgqljewcfwfsmgredjgkcfdrnuzlnajc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/fkykzknipfuifsrxhchzqiosqwoxblcs HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/vfrfjpxegpxqmqsejsipbaqozqvjorcy HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:26 +0000] "DELETE /devstoreaccount1/cont/owzqkjjcbtoszzqoqlgzgazitaguswue HTTP/1.1" 202 -
2026-02-18 05:32:26 02241_filesystem_cache_on_write_operations: [ OK ] 36.03 sec.
2026-02-18 05:32:27 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.53 sec.
2026-02-18 05:32:28 02240_filesystem_query_cache: [ OK ] 0.58 sec.
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/aleemqkqmmqutccfdovbduqtzniteief HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/ejqgapcwktkagexwswwepejamjodpnqk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/dwiwohdznprwbvvgwhsldquxlqfzcjiq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/ggouesjnqiqrydbmeobwdsctidsudeye HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/vpgpdnzwkikympxranctlmgrzwiwetqf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/dephgljxvbxcfmzxprwtixwuynvdrzjr HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/qdjwxdofbdcqdckgcedlrcekuprsryyw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/bifhyhnjtedwaccmelrsxmxwotollglt HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/dspayqmrrnpowwsvaqihxolpyrfafchv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:38 +0000] "PUT /devstoreaccount1/cont/mdrkmjpiqkyalyipyrkixmenirqnvoef HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:39 +0000] "GET /devstoreaccount1/cont/dwiwohdznprwbvvgwhsldquxlqfzcjiq HTTP/1.1" 206 80
127.0.0.1 - - [18/Feb/2026:05:32:39 +0000] "GET /devstoreaccount1/cont/ejqgapcwktkagexwswwepejamjodpnqk HTTP/1.1" 206 746
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "GET /devstoreaccount1/cont/dwiwohdznprwbvvgwhsldquxlqfzcjiq HTTP/1.1" 206 80
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "GET /devstoreaccount1/cont/ejqgapcwktkagexwswwepejamjodpnqk HTTP/1.1" 206 746
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/mdrkmjpiqkyalyipyrkixmenirqnvoef HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/qdjwxdofbdcqdckgcedlrcekuprsryyw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/vpgpdnzwkikympxranctlmgrzwiwetqf HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/ejqgapcwktkagexwswwepejamjodpnqk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/dwiwohdznprwbvvgwhsldquxlqfzcjiq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/ggouesjnqiqrydbmeobwdsctidsudeye HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/dephgljxvbxcfmzxprwtixwuynvdrzjr HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/dspayqmrrnpowwsvaqihxolpyrfafchv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/bifhyhnjtedwaccmelrsxmxwotollglt HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:41 +0000] "DELETE /devstoreaccount1/cont/aleemqkqmmqutccfdovbduqtzniteief HTTP/1.1" 202 -
2026-02-18 05:32:41 02240_system_filesystem_cache_table: [ OK ] 13.78 sec.
2026-02-18 05:32:41 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec.
2026-02-18 05:32:41 Reason: disabled
2026-02-18 05:32:44 02227_test_create_empty_sqlite_db: [ OK ] 2.79 sec.
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/kniqougflrigzvyizkiwowudyraqngjf HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/zfrdlnxdpjmkyxknjgsynyhtzxjeegms HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/iaodgzbmnqmvwlomevjrlywhmopankvk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/liyqlzptshfyjqdqutprmukvsrerjewc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/soxacibwlzwlzjoytucxiewveakkcdeo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/ozxzkimtwfldjofurzuftiaxffqdeoix HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/hmszcyoqarwbmmwqifdecdkhhewdanhg HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:53 +0000] "PUT /devstoreaccount1/cont/ksilsmeaceabxklcfsrevlgnvzycaghz HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:54 +0000] "PUT /devstoreaccount1/cont/katbsqhptmkhmnqdqlbdzazmgkgdyzax HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:54 +0000] "PUT /devstoreaccount1/cont/gopgyuowzbuhdukphpqvfauosbkerdxx HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:54 +0000] "GET /devstoreaccount1/cont/iaodgzbmnqmvwlomevjrlywhmopankvk HTTP/1.1" 206 62
127.0.0.1 - - [18/Feb/2026:05:32:54 +0000] "GET /devstoreaccount1/cont/zfrdlnxdpjmkyxknjgsynyhtzxjeegms HTTP/1.1" 206 100265
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/joglktgqbdcamtyksqczjjwgbmgvtvmc HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/emflzkaxvwbylcesdizggsfrhpzidpnd HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/uwesdsdhedjptokvkjlqmsczkskosfwo HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/irihilexudfghfewpqepqqbprpxkvgen HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/hfqhysuaffnuwhmxaqqofmjcntlvchyq HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/gopgyuowzbuhdukphpqvfauosbkerdxx HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/hmszcyoqarwbmmwqifdecdkhhewdanhg HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/soxacibwlzwlzjoytucxiewveakkcdeo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/iaodgzbmnqmvwlomevjrlywhmopankvk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/zfrdlnxdpjmkyxknjgsynyhtzxjeegms HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/liyqlzptshfyjqdqutprmukvsrerjewc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/ozxzkimtwfldjofurzuftiaxffqdeoix HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/katbsqhptmkhmnqdqlbdzazmgkgdyzax HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/ksilsmeaceabxklcfsrevlgnvzycaghz HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/euuxvuhkrblscpwkjlidqdfyzlonfuuk HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/cyjdqimnttcpdbnzhvhcxsxgijuyezrv HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/ceuzbdbecmamfwklgfequwfetanxgnre HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/ypwgchctshzbkhxybwvucodjfgbgrjug HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/taqqlmdhnwdkcplzutfxrjiiliebvhdw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/xlegyomoulphrjscjtvlenyvencflaxw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/mvpdguhyfwygqepxnzpzfcvkwdmurduw HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/tyipjjfurunggijtkvecbeacitpcpdch HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "PUT /devstoreaccount1/cont/dihbomrgxixbvizxjitzivowatmhsopl HTTP/1.1" 201 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/hfqhysuaffnuwhmxaqqofmjcntlvchyq HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/emflzkaxvwbylcesdizggsfrhpzidpnd HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/joglktgqbdcamtyksqczjjwgbmgvtvmc HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/ufobqnxnpfshrjonaedbrxfmzngckgbb HTTP/1.1" 404 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/mtizdeaaqydofwzkcduxsitniyzwpcga HTTP/1.1" 404 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/smfsupmbytvmujlqhgowidctgyqrmawe HTTP/1.1" 404 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/irihilexudfghfewpqepqqbprpxkvgen HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/uwesdsdhedjptokvkjlqmsczkskosfwo HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/dihbomrgxixbvizxjitzivowatmhsopl HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/xlegyomoulphrjscjtvlenyvencflaxw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/ypwgchctshzbkhxybwvucodjfgbgrjug HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/cyjdqimnttcpdbnzhvhcxsxgijuyezrv HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/euuxvuhkrblscpwkjlidqdfyzlonfuuk HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/ceuzbdbecmamfwklgfequwfetanxgnre HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/taqqlmdhnwdkcplzutfxrjiiliebvhdw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/tyipjjfurunggijtkvecbeacitpcpdch HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/mvpdguhyfwygqepxnzpzfcvkwdmurduw HTTP/1.1" 202 -
127.0.0.1 - - [18/Feb/2026:05:32:57 +0000] "DELETE /devstoreaccount1/cont/kniqougflrigzvyizkiwowudyraqngjf HTTP/1.1" 202 -
2026-02-18 05:32:57 02226_filesystem_cache_profile_events: [ OK ] 13.12 sec.
2026-02-18 05:32:59 02225_unwinder_dwarf_version: [ OK ] 1.48 sec.
2026-02-18 05:33:06 02222_create_table_without_columns_metadata: [ OK ] 7.41 sec.
2026-02-18 05:33:12 02207_allow_plaintext_and_no_password: [ OK ] 5.35 sec.
2026-02-18 05:33:16 02185_values_schema_inference: [ OK ] 3.95 sec.
2026-02-18 05:33:18 02184_ipv6_parsing: [ OK ] 2.39 sec.
2026-02-18 05:33:20 02182_json_each_row_schema_inference: [ OK ] 1.69 sec.
2026-02-18 05:33:21 02179_dict_reload_on_cluster: [ OK ] 0.88 sec.
2026-02-18 05:33:22 02177_temporary_table_current_database_http_session: [ OK ] 1.24 sec.
2026-02-18 05:33:23 02168_avro_bug: [ OK ] 0.68 sec.
2026-02-18 05:33:25 02166_arrow_dictionary_inference: [ OK ] 2.18 sec.
2026-02-18 05:33:26 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 1.08 sec.
2026-02-18 05:33:27 02148_sql_user_defined_function_subquery: [ OK ] 0.88 sec.
2026-02-18 05:33:28 02126_identity_user_defined_function: [ OK ] 0.68 sec.
2026-02-18 05:33:29 02125_recursive_sql_user_defined_functions: [ OK ] 0.89 sec.
2026-02-18 05:33:29 02125_many_mutations_2: [ SKIPPED ] 0.00 sec.
2026-02-18 05:33:29 Reason: not running for current build
2026-02-18 05:33:32 02105_table_function_file_partiotion_by: [ OK ] 3.35 sec.
2026-02-18 05:33:35 02104_json_strings_nullable_string: [ OK ] 2.29 sec.
2026-02-18 05:33:35 02103_sql_user_defined_functions_composition: [ OK ] 0.68 sec.
2026-02-18 05:33:47 02103_tsv_csv_custom_null_representation: [ OK ] 12.13 sec.
2026-02-18 05:33:48 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.73 sec.
2026-02-18 05:33:49 02098_sql_user_defined_functions_aliases: [ OK ] 0.64 sec.
2026-02-18 05:33:50 02096_sql_user_defined_function_alias: [ OK ] 0.63 sec.
2026-02-18 05:33:51 02096_rename_atomic_hang: [ OK ] 0.93 sec.
2026-02-18 05:33:55 02051_read_settings: [ OK ] 4.10 sec.
2026-02-18 05:33:56 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 1.33 sec.
2026-02-18 05:34:17 02026_storage_filelog_largefile: [ OK ] 20.67 sec.
2026-02-18 05:34:18 02025_dictionary_view_different_db: [ OK ] 0.73 sec.
2026-02-18 05:34:18 02015_column_default_dict_get_identifier: [ OK ] 0.78 sec.
2026-02-18 05:34:22 02015_global_in_threads: [ OK ] 3.39 sec.
2026-02-18 05:34:23 02011_dictionary_empty_attribute_list: [ OK ] 0.73 sec.
2026-02-18 05:34:23 01999_grant_with_replace: [ OK ] 0.83 sec.
2026-02-18 05:34:24 01948_dictionary_quoted_database_name: [ OK ] 0.78 sec.
2026-02-18 05:34:25 01915_create_or_replace_dictionary: [ OK ] 0.93 sec.
2026-02-18 05:34:26 01913_exact_rows_before_limit_full: [ OK ] 0.93 sec.
2026-02-18 05:34:27 01910_view_dictionary: [ OK ] 0.94 sec.
2026-02-18 05:34:29 01903_ssd_cache_dictionary_array_type: [ OK ] 1.89 sec.
2026-02-18 05:34:30 01902_table_function_merge_db_repr: [ OK ] 1.18 sec.
2026-02-18 05:34:32 01901_test_attach_partition_from: [ OK ] 1.89 sec.
2026-02-18 05:34:34 01889_postgresql_protocol_null_fields: [ OK ] 1.89 sec.
2026-02-18 05:34:35 01870_buffer_flush: [ OK ] 0.73 sec.
2026-02-18 05:34:36 01856_create_function: [ OK ] 0.98 sec.
2026-02-18 05:34:39 01853_dictionary_cache_duplicates: [ OK ] 3.39 sec.
2026-02-18 05:34:40 01850_dist_INSERT_preserve_error: [ OK ] 0.78 sec.
2026-02-18 05:34:41 01837_database_memory_ddl_dictionaries: [ OK ] 0.83 sec.
2026-02-18 05:34:42 01821_table_comment: [ OK ] 0.83 sec.
2026-02-18 05:34:43 01785_dictionary_element_count: [ OK ] 1.18 sec.
2026-02-18 05:34:44 01778_hierarchical_dictionaries: [ OK ] 1.19 sec.
2026-02-18 05:34:46 01754_direct_dictionary_complex_key: [ OK ] 1.64 sec.
2026-02-18 05:34:48 01753_direct_dictionary_simple_key: [ OK ] 1.89 sec.
2026-02-18 05:34:50 01747_executable_pool_dictionary_implicit_key: [ OK ] 2.04 sec.
2026-02-18 05:34:52 01746_executable_pool_dictionary: [ OK ] 2.04 sec.
2026-02-18 05:34:57 01737_clickhouse_server_wait_server_pool_long: [ OK ] 4.59 sec.
2026-02-18 05:35:01 01722_long_brotli_http_compression_json_format: [ OK ] 3.94 sec.
2026-02-18 05:35:02 01721_engine_file_truncate_on_insert: [ OK ] 0.78 sec.
API: SYSTEM.config
Time: 05:35:05 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": context deadline exceeded', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
2026-02-18 05:35:13 01710_projection_vertical_merges: [ OK ] 10.77 sec.
2026-02-18 05:35:14 01681_cache_dictionary_simple_key: [ OK ] 1.59 sec.
2026-02-18 05:35:15 01676_dictget_in_default_expression: [ OK ] 1.03 sec.
2026-02-18 05:35:16 01670_dictionary_create_key_expression: [ OK ] 0.99 sec.
2026-02-18 05:35:17 01646_system_restart_replicas_smoke: [ OK ] 0.78 sec.
2026-02-18 05:35:20 01643_replicated_merge_tree_fsync_smoke: [ OK ] 3.04 sec.
2026-02-18 05:35:21 01615_random_one_shard_insertion: [ OK ] 1.03 sec.
2026-02-18 05:35:22 01603_rename_overwrite_bug: [ OK ] 0.88 sec.
2026-02-18 05:36:09 01600_detach_permanently: [ OK ] 46.71 sec.
2026-02-18 05:37:11 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 61.73 sec.
2026-02-18 05:37:11 01575_disable_detach_table_of_dictionary: [ OK ] 0.68 sec.
2026-02-18 05:37:13 01530_drop_database_atomic_sync: [ OK ] 1.33 sec.
2026-02-18 05:37:15 01527_clickhouse_local_optimize: [ OK ] 1.84 sec.
2026-02-18 05:37:16 01526_complex_key_dict_direct_layout: [ OK ] 0.83 sec.
2026-02-18 05:37:18 01524_do_not_merge_across_partitions_select_final: [ OK ] 2.29 sec.
2026-02-18 05:37:19 01517_drop_mv_with_inner_table: [ OK ] 0.89 sec.
2026-02-18 05:37:23 01507_clickhouse_server_start_with_embedded_config: [ OK ] 3.89 sec.
2026-02-18 05:37:25 01501_cache_dictionary_all_fields: [ OK ] 2.49 sec.
2026-02-18 05:37:29 01474_executable_dictionary: [ OK ] 4.15 sec.
2026-02-18 05:37:31 01471_calculate_ttl_during_merge: [ OK ] 0.98 sec.
2026-02-18 05:38:04 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 33.01 sec.
2026-02-18 05:38:04 01459_manual_write_to_replicas: [ SKIPPED ] 0.00 sec.
2026-02-18 05:38:04 Reason: not running for current build
2026-02-18 05:38:04 01457_create_as_table_function_structure: [ OK ] 0.83 sec.
2026-02-18 05:38:05 01455_rank_correlation_spearman: [ OK ] 0.88 sec.
2026-02-18 05:38:29 01454_storagememory_data_race_challenge: [ OK ] 23.42 sec.
2026-02-18 05:38:37 01417_freeze_partition_verbose_zookeeper: [ OK ] 7.91 sec.
2026-02-18 05:38:51 01417_freeze_partition_verbose: [ OK ] 14.43 sec.
2026-02-18 05:39:39 01414_mutations_and_errors_zookeeper: [ OK ] 48.03 sec.
2026-02-18 05:39:47 01410_nullable_key_more_tests: [ OK ] 7.46 sec.
2026-02-18 05:39:55 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 8.12 sec.
2026-02-18 05:39:58 01360_materialized_view_with_join_on_query_log: [ OK ] 2.79 sec.
2026-02-18 05:39:59 01356_view_threads: [ OK ] 1.38 sec.
2026-02-18 05:40:12 01320_create_sync_race_condition_zookeeper: [ OK ] 13.08 sec.
2026-02-18 05:40:21 01307_multiple_leaders_zookeeper: [ OK ] 9.02 sec.
2026-02-18 05:40:34 01305_replica_create_drop_zookeeper: [ OK ] 12.28 sec.
2026-02-18 05:41:07 01301_aggregate_state_exception_memory_leak: [ OK ] 32.66 sec.
2026-02-18 05:41:08 01297_create_quota: [ OK ] 1.79 sec.
2026-02-18 05:41:09 01295_create_row_policy: [ OK ] 0.93 sec.
2026-02-18 05:41:10 01294_system_distributed_on_cluster: [ OK ] 0.93 sec.
2026-02-18 05:41:11 01294_create_settings_profile: [ OK ] 1.18 sec.
2026-02-18 05:41:13 01293_system_distribution_queue: [ OK ] 0.98 sec.
2026-02-18 05:41:13 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.83 sec.
2026-02-18 05:41:19 01281_group_by_limit_memory_tracking: [ OK ] 5.10 sec.
2026-02-18 05:41:24 01280_ssd_complex_key_dictionary: [ OK ] 5.55 sec.
2026-02-18 05:43:23 01275_parallel_mv: [ OK ] 119.02 sec.
2026-02-18 05:43:25 01251_dict_is_in_infinite_loop: [ OK ] 1.39 sec.
2026-02-18 05:43:25 01225_show_create_table_from_dictionary: [ OK ] 0.63 sec.
2026-02-18 05:44:09 01192_rename_database_zookeeper: [ OK ] 43.56 sec.
2026-02-18 05:44:10 01164_alter_memory_database: [ OK ] 0.78 sec.
2026-02-18 05:44:11 01155_rename_move_materialized_view: [ OK ] 1.64 sec.
2026-02-18 05:45:33 01154_move_partition_long: [ OK ] 81.35 sec.
2026-02-18 05:45:34 01153_attach_mv_uuid: [ OK ] 1.03 sec.
2026-02-18 05:45:36 01148_zookeeper_path_macros_unfolding: [ OK ] 2.04 sec.
2026-02-18 05:45:37 01119_weird_user_names: [ OK ] 0.78 sec.
2026-02-18 05:46:02 01111_create_drop_replicated_db_stress: [ OK ] 25.38 sec.
2026-02-18 05:46:03 01110_dictionary_layout_without_arguments: [ OK ] 0.68 sec.
2026-02-18 05:46:04 01103_distributed_product_mode_local_column_renames: [ OK ] 1.23 sec.
2026-02-18 05:46:12 01098_temporary_and_external_tables: [ OK ] 7.81 sec.
2026-02-18 05:46:15 01091_num_threads: [ OK ] 2.64 sec.
2026-02-18 05:46:17 01085_max_distributed_connections_http: [ OK ] 2.13 sec.
2026-02-18 05:47:01 01083_expressions_in_engine_arguments: [ OK ] 44.37 sec.
2026-02-18 05:47:03 01082_window_view_watch_limit: [ OK ] 2.14 sec.
2026-02-18 05:47:42 01079_parallel_alter_detach_table_zookeeper: [ OK ] 38.93 sec.
2026-02-18 05:47:51 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 8.87 sec.
2026-02-18 05:47:52 01075_allowed_client_hosts: [ OK ] 0.73 sec.
2026-02-18 05:47:56 01075_window_view_proc_tumble_to_now_populate: [ OK ] 3.79 sec.
2026-02-18 05:47:57 01070_materialize_ttl: [ OK ] 1.38 sec.
2026-02-18 05:47:59 01070_mutations_with_dependencies: [ OK ] 1.48 sec.
2026-02-18 05:48:01 01070_modify_ttl: [ OK ] 1.64 sec.
2026-02-18 05:48:10 01069_window_view_proc_tumble_watch: [ OK ] 9.31 sec.
2026-02-18 05:48:12 01065_window_view_event_hop_watch_bounded: [ OK ] 1.64 sec.
2026-02-18 05:48:15 01060_shutdown_table_after_detach: [ OK ] 2.93 sec.
2026-02-18 05:48:20 01055_window_view_proc_hop_to: [ OK ] 5.90 sec.
2026-02-18 05:48:24 01053_ssd_dictionary: [ OK ] 3.95 sec.
2026-02-18 05:48:35 01038_dictionary_lifetime_min_zero_sec: [ OK ] 10.12 sec.
2026-02-18 05:48:36 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.83 sec.
2026-02-18 05:48:37 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.93 sec.
2026-02-18 05:48:38 01023_materialized_view_query_context: [ OK ] 0.93 sec.
2026-02-18 05:48:52 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 13.99 sec.
2026-02-18 05:48:58 01018_ddl_dictionaries_bad_queries: [ OK ] 6.45 sec.
2026-02-18 05:49:24 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 25.68 sec.
2026-02-18 05:49:43 01014_lazy_database_basic: [ OK ] 19.45 sec.
2026-02-18 05:49:47 01013_sync_replica_timeout_zookeeper: [ OK ] 4.10 sec.
2026-02-18 05:50:02 01007_r1r2_w_r2r1_deadlock: [ OK ] 14.68 sec.
2026-02-18 05:50:17 01004_rename_deadlock: [ OK ] 15.24 sec.
2026-02-18 05:50:19 00985_merge_stack_overflow: [ OK ] 1.84 sec.
2026-02-18 05:50:21 00971_query_id_in_logs: [ OK ] 1.74 sec.
2026-02-18 05:50:22 00963_achimbab: [ OK ] 0.73 sec.
2026-02-18 05:50:24 00950_dict_get: [ OK ] 2.09 sec.
2026-02-18 05:50:28 00877_memory_limit_for_new_delete: [ OK ] 3.84 sec.
2026-02-18 05:50:28 00840_long_concurrent_select_and_drop_deadlock: [ SKIPPED ] 0.00 sec.
2026-02-18 05:50:28 Reason: not running for current build
2026-02-18 05:50:29 00722_inner_join: [ OK ] 1.03 sec.
2026-02-18 05:50:30 00693_max_block_size_system_tables_columns: [ OK ] 1.08 sec.
2026-02-18 05:50:38 00623_truncate_table_throw_exception: [ OK ] 7.71 sec.
2026-02-18 05:50:40 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 1.88 sec.
2026-02-18 05:50:51 00463_long_sessions_in_http_interface: [ OK ] 11.43 sec.
2026-02-18 05:50:52 00332_quantile_timing_memory_leak: [ OK ] 0.78 sec.
2026-02-18 05:50:53 00309_formats_case_insensitive: [ OK ] 0.73 sec.
2026-02-18 05:50:53 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec.
2026-02-18 05:50:53 Reason: skip
2026-02-18 05:50:53
2026-02-18 05:50:53 270 tests passed. 12 tests skipped. 2222.87 s elapsed (MainProcess).
2026-02-18 05:50:54 Won't run stateful tests because test data wasn't loaded.
2026-02-18 05:50:54 Checking the hung queries: done
2026-02-18 05:50:54
2026-02-18 05:50:54 No queries hung.
2026-02-18 05:50:54 All tests have finished.
2026-02-18 05:50:54
2026-02-18 05:50:54 Top patterns of log messages:
2026-02-18 05:50:54
2026-02-18 05:50:54 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-02-18 05:50:54
2026-02-18 05:50:54 1. 232000 0.085 10.11 MiB 0.038 1 1466 ['Trace'] 1 is disk {} eligible for search: {}
2026-02-18 05:50:54 2. 118156 0.043 23.56 MiB 0.089 1 222 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2026-02-18 05:50:54 3. 118081 0.043 17.68 MiB 0.067 37126 219 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2026-02-18 05:50:54 4. 108065 0.04 2.60 MiB 0.01 1 689 ['Trace'] 0.001 Query to stage {}{}
2026-02-18 05:50:54 5. 106746 0.039 5.03 MiB 0.019 1 689 ['Trace'] 0.001 Query from stage {} to stage {}{}
2026-02-18 05:50:54 6. 94085 0.034 2.59 MiB 0.01 1 136 ['Debug'] 0 Processed in {} sec.
2026-02-18 05:50:54 7. 92071 0.034 4.02 MiB 0.015 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2026-02-18 05:50:54 8. 77598 0.028 2.49 MiB 0.009 1 1721 ['Trace'] 0 Aggregation method: {}
2026-02-18 05:50:54 9. 72754 0.027 6.45 MiB 0.024 1 1719 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-02-18 05:50:54 10. 69858 0.026 5.51 MiB 0.021 1 198 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2026-02-18 05:50:54 11. 57709 0.021 4.56 MiB 0.017 1 1657 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2026-02-18 05:50:54 12. 54503 0.02 3.74 MiB 0.014 1 1930 ['Trace'] 0.461 Reserved {} on local disk {}, having unreserved {}.
2026-02-18 05:50:54 13. 52445 0.019 563.37 KiB 0.002 1 1709 ['Trace'] 0 Aggregating
2026-02-18 05:50:54 14. 50539 0.019 5.70 MiB 0.021 2803 1435 ['Trace'] 0.331 Renaming temporary part {} to {} with tid {}.
2026-02-18 05:50:54 15. 48921 0.018 3.31 MiB 0.012 2791 1920 ['Trace'] 0.419 Trying to reserve {} using storage policy from min volume index {}
2026-02-18 05:50:54 16. 44336 0.016 2.02 MiB 0.008 1 1420 ['Trace'] 0.185 filled checksums {}
2026-02-18 05:50:54 17. 39709 0.015 1.85 MiB 0.007 1 202 ['Debug'] 0.203 Peak memory usage{}: {}.
2026-02-18 05:50:54 18. 37509 0.014 1.70 MiB 0.006 37509 376 ['Debug'] 0.995 Authenticating user '{}' from {}
2026-02-18 05:50:54 19. 37486 0.014 4.11 MiB 0.015 37486 376 ['Debug'] 0.995 {} Authenticated with global context as user {}
2026-02-18 05:50:54 20. 37438 0.014 3.21 MiB 0.012 37438 369 ['Debug'] 0.995 {} Logout, user_id: {}
2026-02-18 05:50:54 21. 37077 0.014 2.65 MiB 0.01 37077 219 ['Debug'] 1 Creating session context with user_id: {}
2026-02-18 05:50:54 22. 29511 0.011 5.97 MiB 0.022 3 196 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2026-02-18 05:50:54 23. 29502 0.011 20.00 MiB 0.075 2 196 ['Trace'] 1 Request URI: {}
2026-02-18 05:50:54 24. 28936 0.011 593.41 KiB 0.002 2 196 ['Debug'] 0.263 Done processing query
2026-02-18 05:50:54 25. 24068 0.009 699.30 KiB 0.003 1735 284 ['Debug'] 0.005 Key condition: {}
2026-02-18 05:50:54 26. 23582 0.009 2.14 MiB 0.008 1 86 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2026-02-18 05:50:54 27. 23386 0.009 1.81 MiB 0.007 1572 223 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2026-02-18 05:50:54 28. 21836 0.008 2.53 MiB 0.01 1 2 ['Trace'] 1 Creating part at path {}
2026-02-18 05:50:54 29. 21788 0.008 957.48 KiB 0.004 1730 284 ['Trace'] 0.005 Filtering marks by primary and secondary keys
2026-02-18 05:50:54 30. 21521 0.008 2.39 MiB 0.009 1723 284 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2026-02-18 05:50:54 31. 21395 0.008 480.55 KiB 0.002 1 1554 ['Trace'] 0 Merging aggregated data
2026-02-18 05:50:54 32. 21113 0.008 1.62 MiB 0.006 718 1900 ['Trace'] 0.906 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2026-02-18 05:50:54 33. 20691 0.008 1.83 MiB 0.007 443 523 ['Trace'] 0.998 Insert entry {} to queue with type {}
2026-02-18 05:50:54 34. 20071 0.007 1.01 MiB 0.004 1508 283 ['Trace'] 0.005 Spreading mark ranges among streams (default reading)
2026-02-18 05:50:54 35. 18662 0.007 1.56 MiB 0.006 836 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2026-02-18 05:50:54 36. 18239 0.007 2.48 MiB 0.009 637 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2026-02-18 05:50:54 37. 16538 0.006 419.91 KiB 0.002 443 523 ['Debug'] 0.998 Pulled {} entries to queue.
2026-02-18 05:50:54 38. 16538 0.006 952.87 KiB 0.004 443 523 ['Debug'] 0.998 Pulling {} entries to queue: {} - {}
2026-02-18 05:50:54 39. 15879 0.006 520.51 KiB 0.002 2 144 ['Trace'] 1 TCP Request. Address: {}
2026-02-18 05:50:54 40. 15877 0.006 1.50 MiB 0.006 1 144 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2026-02-18 05:50:54 41. 15807 0.006 416.79 KiB 0.002 1 136 ['Debug'] 1 Done processing connection.
2026-02-18 05:50:54 42. 14609 0.005 1.56 MiB 0.006 1 64 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2026-02-18 05:50:54 43. 12110 0.004 721.40 KiB 0.003 3577 185 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables.
2026-02-18 05:50:54 44. 12110 0.004 508.53 KiB 0.002 3577 185 ['Debug'] 0.011 Found {} non used tables in detached tables.
2026-02-18 05:50:54 45. 12007 0.004 926.32 KiB 0.003 1 140 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2026-02-18 05:50:54 46. 10411 0.004 397.10 KiB 0.001 335 35 ['Debug'] 0.73 Committing part {} to zookeeper
2026-02-18 05:50:54 47. 9966 0.004 369.38 KiB 0.001 332 32 ['Debug'] 0.762 Part {} committed to zookeeper
2026-02-18 05:50:54 48. 9273 0.003 326.02 KiB 0.001 1 40 ['Trace'] 1 Keeper request. Address: {}
2026-02-18 05:50:54 49. 9221 0.003 932.50 KiB 0.003 248 33 ['Debug'] 1 Fetching part {} from {}:{}
2026-02-18 05:50:54 50. 9093 0.003 1.27 MiB 0.005 1 133 ['Trace'] 0.017 PREWHERE condition was split into {} steps: {}
2026-02-18 05:50:54 51. 8659 0.003 346.70 KiB 0.001 189 527 ['Debug'] 0.563 Will use old analyzer to prepare mutation
2026-02-18 05:50:54 52. 8420 0.003 669.98 KiB 0.002 1 1495 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2026-02-18 05:50:54 53. 8328 0.003 292.78 KiB 0.001 1 1034 ['Trace'] 0.008 Converting aggregated data to blocks
2026-02-18 05:50:54 54. 8298 0.003 243.11 KiB 0.001 830 519 ['Debug'] 0.995 Updating strategy picker state
2026-02-18 05:50:54 55. 8293 0.003 886.58 KiB 0.003 1 1025 ['Debug'] 0.005 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-02-18 05:50:54 56. 8056 0.003 692.31 KiB 0.003 248 36 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2026-02-18 05:50:54 57. 8056 0.003 291.05 KiB 0.001 248 36 ['Trace'] 1 Checking disk {} with type {}
2026-02-18 05:50:54 58. 7681 0.003 708.17 KiB 0.003 14 17 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL
2026-02-18 05:50:54 59. 7633 0.003 238.53 KiB 0.001 1 27 ['Debug'] 1 Receive four letter command {}
2026-02-18 05:50:54 60. 7603 0.003 163.20 KiB 0.001 204 60 ['Trace'] 1 Sending part {}
2026-02-18 05:50:54 61. 7599 0.003 147.08 KiB 0.001 246 37 ['Debug'] 1 Downloading files {}
2026-02-18 05:50:54 62. 7596 0.003 645.35 KiB 0.002 246 37 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2026-02-18 05:50:54 63. 7592 0.003 400.22 KiB 0.001 243 37 ['Debug'] 1 Download of part {} onto disk {} finished.
2026-02-18 05:50:54 64. 7592 0.003 333.49 KiB 0.001 243 37 ['Debug'] 1 Downloading part {} onto disk {}.
2026-02-18 05:50:54 65. 7588 0.003 751.31 KiB 0.003 245 33 ['Debug'] 1 Fetched part {} from {}:{}{}
2026-02-18 05:50:54 66. 7561 0.003 288.06 KiB 0.001 352 154 ['Debug'] 0.011 Reading approx. {} rows with {} streams
2026-02-18 05:50:54 67. 7462 0.003 436.95 KiB 0.002 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2026-02-18 05:50:54 68. 7461 0.003 272.40 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {}
2026-02-18 05:50:54 69. 7329 0.003 538.55 KiB 0.002 1 1356 ['Debug'] 1 Execute load job '{}' in {}
2026-02-18 05:50:54 70. 7329 0.003 560.02 KiB 0.002 1 99 ['Debug'] 0.001 Schedule load job '{}' into {}
2026-02-18 05:50:54 71. 7329 0.003 286.29 KiB 0.001 1 1452 ['Debug'] 0.5 Spawn loader worker #{} in {}
2026-02-18 05:50:54 72. 7329 0.003 207.56 KiB 0.001 1 1516 ['Debug'] 1 Stop worker in {}
2026-02-18 05:50:54 73. 7329 0.003 509.92 KiB 0.002 1 1356 ['Debug'] 1 Finish load job '{}' with status {}
2026-02-18 05:50:54 74. 7328 0.003 681.61 KiB 0.003 1 99 ['Debug'] 0 Prioritize load job '{}': {} -> {}
2026-02-18 05:50:54 75. 7303 0.003 64.19 KiB 0 2 99 ['Trace'] 0.001 No tables
2026-02-18 05:50:54 76. 7292 0.003 242.12 KiB 0.001 1 1471 ['Debug'] 0.5 Change current priority: {} -> {}
2026-02-18 05:50:54 77. 7253 0.003 366.95 KiB 0.001 669 590 ['Debug'] 0.889 Selected {} parts from {} to {}
2026-02-18 05:50:54 78. 6820 0.003 473.72 KiB 0.002 252 1272 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks)
2026-02-18 05:50:54 79. 6820 0.003 201.96 KiB 0.001 252 1272 ['Trace'] 0.009 Found (RIGHT) boundary mark: {}
2026-02-18 05:50:54 80. 6820 0.003 194.88 KiB 0.001 252 1272 ['Trace'] 0.009 Found (LEFT) boundary mark: {}
2026-02-18 05:50:54 81. 6820 0.003 208.01 KiB 0.001 252 1272 ['Trace'] 0.009 Found {} range {}in {} steps
2026-02-18 05:50:54 82. 6677 0.002 426.29 KiB 0.002 74 418 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem
2026-02-18 05:50:54 83. 6588 0.002 225.46 KiB 0.001 369 107 ['Debug'] 0.001 MinMax index condition: {}
2026-02-18 05:50:54 84. 6581 0.002 818.35 KiB 0.003 9 510 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now.
2026-02-18 05:50:54 85. 6466 0.002 1.26 MiB 0.005 1 1466 ['Information'] 1 Removing metadata {} of dropped table {}
2026-02-18 05:50:54 86. 6464 0.002 479.75 KiB 0.002 1 110 ['Debug'] 0 Waiting for table {} to be finally dropped
2026-02-18 05:50:54 87. 6464 0.002 744.88 KiB 0.003 1 110 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2026-02-18 05:50:54 88. 6120 0.002 730.01 KiB 0.003 2318 1588 ['Debug'] 0.98 Removing {} parts from filesystem (serially): Parts: [{}]
2026-02-18 05:50:54 89. 6097 0.002 440.62 KiB 0.002 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2026-02-18 05:50:54 90. 5794 0.002 1.10 MiB 0.004 1 293 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2026-02-18 05:50:54 91. 5391 0.002 184.06 KiB 0.001 1 91 ['Debug'] 0 Selected MergeAlgorithm: {}
2026-02-18 05:50:54 92. 5391 0.002 437.24 KiB 0.002 1 91 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2026-02-18 05:50:54 93. 5384 0.002 697.73 KiB 0.003 1 91 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2026-02-18 05:50:54 94. 5375 0.002 335.50 KiB 0.001 501 91 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2026-02-18 05:50:54 95. 5205 0.002 365.87 KiB 0.001 1 559 ['Trace'] 0.82 Rolling back transaction {}{}
2026-02-18 05:50:54 96. 5120 0.002 372.22 KiB 0.001 1 140 ['Trace'] 0.011 The min valid primary key position for moving to the tail of PREWHERE is {}
2026-02-18 05:50:54 97. 4883 0.002 362.73 KiB 0.001 161 1043 ['Trace'] 0.029 Used generic exclusion search {}over index for part {} with {} steps
2026-02-18 05:50:54 98. 4800 0.002 154.73 KiB 0.001 20 63 ['Debug'] 0 Requested flush up to offset {}
2026-02-18 05:50:54 99. 4533 0.002 274.89 KiB 0.001 1 134 ['Trace'] 0.013 Condition {} moved to PREWHERE
2026-02-18 05:50:54 100. 4396 0.002 318.26 KiB 0.001 410 476 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2026-02-18 05:50:54
2026-02-18 05:50:54 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-02-18 05:50:54
2026-02-18 05:50:54
2026-02-18 05:50:54
2026-02-18 05:50:54 Top messages without format string (fmt::runtime):
2026-02-18 05:50:54
2026-02-18 05:50:54 count pattern runtime_message line
2026-02-18 05:50:54
2026-02-18 05:50:54 1. 1476 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2026-02-18 05:50:54 2. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 27 ('expand'): expand c, d;. Max query size exceeded: 'expand'. (SYNTAX_ERROR) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:44000) (comment: 02366_kql_mvexpand.sql) (in query: m ('/executeQuery.cpp',221)
2026-02-18 05:50:54 3. 10 CodeDBExceptionReceivedfromDBExc Code: 507. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Sharding key modulo(sub_key, 2) is not used. Stack trace:
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164928 ('/executeQuery.cpp',221)
2026-02-18 05:50:54 4. 8 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace:
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String ('/executeQuery.cpp',221)
2026-02-18 05:50:54 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:35256) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221)
2026-02-18 05:50:54 6. 6 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 1 (' '): . Unrecognized token: ' '. (SYNTAX_ERROR) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:41340) (comment: 00746_sql_fuzzy.sh) (in query: SELEC ('/executeQuery.cpp',221)
2026-02-18 05:50:54 7. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2026-02-18 05:50:54 8. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:49456) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221)
2026-02-18 05:50:54 9. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:47008) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2026-02-18 05:50:54 10. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221)
2026-02-18 05:50:54 11. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221)
2026-02-18 05:50:54 12. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10527.a ('/executeQuery.cpp',221)
2026-02-18 05:50:54 13. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10527.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:44836) (in query: ), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-projec ('/executeQuery.cpp',221)
2026-02-18 05:50:54 14. 1 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 15. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:33506) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221)
2026-02-18 05:50:54 16. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-project/libcxx/include/exception:14 ('/TCPHandler.cpp',765)
2026-02-18 05:50:54 17. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0)
2026-02-18 05:50:54 18. 1 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::URISyntaxException::U ('/TCPHandler.cpp',765)
2026-02-18 05:50:54 19. 1 startingup starting up ('',0)
2026-02-18 05:50:54 20. 1 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'POLYGON'' in (QS=vLm). (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:50:54
2026-02-18 05:50:54 0. /build/contrib/llvm-project/libcxx/in ('/TCPHandler.cpp',765)
2026-02-18 05:50:54 21. 1 peerDCIDlocalhostvotingmembermyi peer 1: DC ID 0, localhost:9234, voting member, 1
2026-02-18 05:50:54 my id: 1, voting_member
2026-02-18 05:50:54 num peers: 0 ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 22. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:40834) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in query: ('/executeQuery.cpp',221)
2026-02-18 05:50:54 23. 1 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 24. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10527.altinitytest (revision: 4294967295, git hash: fd36ebaf95d0d6fb496d11b3a9553b4fae0f711a, build id: 38E5D930C201848E4D73178EBDE98F1168BD248F), PID 619 ('',0)
2026-02-18 05:50:54 25. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 26. 1 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 27. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0
2026-02-18 05:50:54 peer 1, DC ID 0, localhost:9234, voting member, 1
2026-02-18 05:50:54 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 28. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43)
2026-02-18 05:50:54 29. 1 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43)
2026-02-18 05:51:01 30. 1 logTraceFunctionTest logTrace Function Test ('/logTrace.cpp',50)
2026-02-18 05:51:01
2026-02-18 05:51:01
2026-02-18 05:51:01
2026-02-18 05:51:01 Top messages not matching their format strings:
2026-02-18 05:51:01
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:01 1. 1508 If the signature check failed. This could be because of a time skew. Attempting to adjust the signer.
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:01 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:54848) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:51:01
2026-02-18 05:51:01 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x0000000016492872
2026-02-18 05:51:01 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179
2026-02-18 05:51:01 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c
2026-02-18 05:51:01 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007af8fcb
2026-02-18 05:51:01 4. /build/src/Functions/FunctionsStringDistance.cpp:0: DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007af881c
2026-02-18 05:51:01 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000007b027b7
2026-02-18 05:51:01 6. /build/src/Common/PODArray.h:208: DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x0000000007b023cf
2026-02-18 05:51:01 7. /build/src/Functions/FunctionsStringSimilarity.h:0: DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007b01c2f
2026-02-18 05:51:01 8. /build/src/Functions/IFunctionAdaptors.h:22: DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000702697a
2026-02-18 05:51:01 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69ca5
2026-02-18 05:51:01 10. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a
2026-02-18 05:51:01 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645
2026-02-18 05:51:01 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000001119e75d
2026-02-18 05:51:01 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000012fbb8b6
2026-02-18 05:51:01 14. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000c90c4f3
2026-02-18 05:51:01 15. /build/src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012d5e689
2026-02-18 05:51:01 16. /build/src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012d78ea9
2026-02-18 05:51:01 17. /build/src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x0000000012d6eb50
2026-02-18 05:51:01 18. /build/contrib/llvm-project/libcxx/include/vector:547: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x0000000012d6eddd
2026-02-18 05:51:01 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000012d6dc4c
2026-02-18 05:51:01 20. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012d6d665
2026-02-18 05:51:01 21. /build/src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012d7bd2a
2026-02-18 05:51:01 22. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c706d2e
2026-02-18 05:51:01 23. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000c70c192
2026-02-18 05:51:01 24. ? @ 0x00007f3171f1dac3
2026-02-18 05:51:01 25. ? @ 0x00007f3171faf850
2026-02-18 05:51:01
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:01 3. Close WriteBufferFromAzureBlobStorage. {}. 5 Close WriteBufferFromAzureBlobStorage. vfrfjpxegpxqmqsejsipbaqozqvjorcy. (LogSeriesLimiter: on interval from 2026-02-18 05:31:34 to 2026-02-18 05:32:13 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:01 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10527.altinitytest (altinity build)) (from [::1]:59936) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests
2026-02-18 05:51:01 -- Even if the fallback is used, invalid substitutions must throw an exception.
2026-02-18 05:51:01 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below):
2026-02-18 05:51:01
2026-02-18 05:51:01 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x0000000016492872
2026-02-18 05:51:01 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179
2026-02-18 05:51:01 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c
2026-02-18 05:51:01 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000b5827ab
2026-02-18 05:51:01 4. /build/src/Functions/ReplaceRegexpImpl.h:0: DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000b586eee
2026-02-18 05:51:01 5. /build/contrib/llvm-project/libcxx/include/string:1624: DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b583b51
2026-02-18 05:51:01 6. /build/src/Functions/IFunction.h:448: DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000701034a
2026-02-18 05:51:01 7. /build/src/Functions/IFunctionAdaptors.h:28: DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070269da
2026-02-18 05:51:01 8. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69c8f
2026-02-18 05:51:01 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a
2026-02-18 05:51:01 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645
2026-02-18 05:51:01 11. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010fd1c81
2026-02-18 05:51:01 12. /build/src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010fd0c94
2026-02-18 05:51:01 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000012fbb572
2026-02-18 05:51:01 14. /build/src/Processors/QueryPlan/ExpressionStep.cpp:20: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x000000001314e6f4
2026-02-18 05:51:01 15. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x00000000104c7c3a
2026-02-18 05:51:01 16. /build/src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x000000001165ba7c
2026-02-18 05:51:01 17. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x0000000011655eea
2026-02-18 05:51:01 18. /build/src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x00000000116513de
2026-02-18 05:51:01 19. /build/src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000001164f5cd
2026-02-18 05:51:01 20. /build/src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x00000000119181ed
2026-02-18 05:51:01 21. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000011913e5d
2026-02-18 05:51:01 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cc2f3b
2026-02-18 05:51:01 23. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012cd9879
2026-02-18 05:51:01 24. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016537e47
2026-02-18 05:51:01 25. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x000000001653831e
2026-02-18 05:51:01 26. /build/base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000164e4b32
2026-02-18 05:51:01 27. /build/base/poco/Foundation/include/Poco/AutoPtr.h:77: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000164e2843
2026-02-18 05:51:01 28. ? @ 0x00007f3171f1dac3
2026-02-18 05:51:01 29. ? @ 0x00007f3171faf850
2026-02-18 05:51:01
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:01 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:42662) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2026-02-18 05:51:01 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
� �'�X+�'�X+�'�URLHashInt64�|3�b.�|3�b.�|3�b.�|3�b.�
2026-02-18 05:51:01 o�e�
�#�\X-h�X v�v�h�9�D�|3�b.�CLIDInt32 � $$); (stage: Complete)
2026-02-18 05:51:01 message_format_string count() any_message
2026-02-18 05:51:01
2026-02-18 05:51:03 6. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 3 /var/lib/clickhouse/store/1ce/1ce491d5-7d78-476c-bf19-9e6d8f6d496d/tmp_merge_202602_1_563_225/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages)
2026-02-18 05:51:03
2026-02-18 05:51:03
2026-02-18 05:51:03
2026-02-18 05:51:03 Top short messages:
2026-02-18 05:51:03
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 1. 113 {} Code: 41. DB::Exception: Value 1 for year must be in the range [1970, 2106]: In scope SELECT parseDateTimeInJodaSyntax(' 26
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 2. 19 Creating {}: {} Creating table test_wguvh4s5.test: CREATE TABLE IF NOT EXISTS test_wguvh4s5.test UUID '605904cf-834a-4143-aa3a-2b6d112dc 124
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 3. 12 Froze {} parts Froze 1 parts -13
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10527.altinitytest (altinity buil 29
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE), Stack trace (when copying this message, always in 29
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10527.altinitytest (altinity bui 27
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 7. 2 Database {} does not exist Code: 81. DB::Exception: Database `\0` does not exist. (UNKNOWN_DATABASE) (version 24.8.14.10527.altinitytest (altinity 29
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 8. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10527.altinitytest (al 29
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 9. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10527.altinitytest (altinity build) 24
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 10. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10527.altinitytest (altinity build 27
2026-02-18 05:51:03 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-02-18 05:51:03
2026-02-18 05:51:03 11. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10527.altinitytest (altinity build 25
2026-02-18 05:51:03
2026-02-18 05:51:03
2026-02-18 05:51:03
2026-02-18 05:51:03 Top messages by level:
2026-02-18 05:51:03
2026-02-18 05:51:03 (0.0008906122867844865,'Failed to push block to view {}, {}') Error
2026-02-18 05:51:03 (0.00022833393196161937,'Not enabled four letter command {}') Warning
2026-02-18 05:51:03 (0.0023698349984973208,'Removing metadata {} of dropped table {}') Information
2026-02-18 05:51:03 (0.04330684708590194,'(from {}{}{}){}{} {} (stage: {})') Debug
2026-02-18 05:51:03 (0.08502965042551476,'is disk {} eligible for search: {}') Trace
2026-02-18 05:51:03
2026-02-18 05:51:03
+ set -e
+ echo 'Files in current directory'
+ ls -la ./
Files in current directory
total 129404
drwxr-xr-x 1 root root 4096 Feb 18 05:39 .
drwxr-xr-x 1 root root 4096 Feb 18 05:39 ..
-rw-rw-r-- 1 1000 1000 119 Feb 18 04:45 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Feb 18 05:32 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Feb 18 05:32 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2057769 Feb 18 05:50 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Feb 18 05:32 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 18 04:45 broken_tests.json
drwxr-x--- 4 root root 4096 Feb 18 05:29 data
drwxr-xr-x 14 root root 3860 Feb 18 04:50 dev
-rwxr-xr-x 1 root root 0 Feb 18 04:50 .dockerenv
drwxr-xr-x 1 root root 4096 Feb 18 04:51 etc
drwxr-x--- 2 root root 4096 Feb 18 05:29 flags
drwxr-x--- 2 root root 4096 Feb 18 05:29 format_schemas
drwxr-xr-x 1 1000 1000 4096 Feb 18 04:52 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Feb 18 05:29 metadata
drwxr-x--- 2 root root 4096 Feb 18 05:29 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Feb 18 04:52 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Feb 18 04:50 package_folder
drwxr-x--- 2 root root 4096 Feb 18 05:34 preprocessed_configs
dr-xr-xr-x 318 root root 0 Feb 18 04:50 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Feb 18 04:59 queries_02352
-rw-r----- 1 root root 1 Feb 18 05:29 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Feb 18 05:29 roles.list
drwx------ 1 root root 4096 Feb 18 05:48 root
-rw-r----- 1 root root 1 Feb 18 05:29 row_policies.list
drwxr-xr-x 1 root root 4096 Feb 18 04:51 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Feb 18 04:52 script.gdb
-rw-r--r-- 1 root root 65861 Feb 18 05:37 server.log
-rw-r----- 1 root root 1 Feb 18 05:29 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r--r-- 1 root root 399 Feb 18 05:05 ssh_key
-rw-r----- 1 root root 65 Feb 18 05:34 status
drwxr-x--- 4 root root 4096 Feb 18 05:29 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 18 04:50 sys
drwxrwxr-x 2 1000 1000 4096 Feb 18 04:52 test_output
drwxrwxrwt 1 root root 4096 Feb 18 05:51 tmp
drwxr-x--- 2 root root 4096 Feb 18 05:29 user_files
-rw-r----- 1 root root 1 Feb 18 05:33 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Feb 18 05:29 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 129404
drwxr-xr-x 1 root root 4096 Feb 18 05:39 .
drwxr-xr-x 1 root root 4096 Feb 18 05:39 ..
-rw-rw-r-- 1 1000 1000 119 Feb 18 04:45 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Feb 18 05:32 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Feb 18 05:32 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2057769 Feb 18 05:50 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Feb 18 05:32 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Feb 18 04:45 broken_tests.json
drwxr-x--- 4 root root 4096 Feb 18 05:29 data
drwxr-xr-x 14 root root 3860 Feb 18 04:50 dev
-rwxr-xr-x 1 root root 0 Feb 18 04:50 .dockerenv
drwxr-xr-x 1 root root 4096 Feb 18 04:51 etc
drwxr-x--- 2 root root 4096 Feb 18 05:29 flags
drwxr-x--- 2 root root 4096 Feb 18 05:29 format_schemas
drwxr-xr-x 1 1000 1000 4096 Feb 18 04:52 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Feb 18 05:29 metadata
drwxr-x--- 2 root root 4096 Feb 18 05:29 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Feb 18 04:52 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Feb 18 04:50 package_folder
drwxr-x--- 2 root root 4096 Feb 18 05:34 preprocessed_configs
dr-xr-xr-x 318 root root 0 Feb 18 04:50 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Feb 18 04:59 queries_02352
-rw-r----- 1 root root 1 Feb 18 05:29 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Feb 18 05:29 roles.list
drwx------ 1 root root 4096 Feb 18 05:48 root
-rw-r----- 1 root root 1 Feb 18 05:29 row_policies.list
drwxr-xr-x 1 root root 4096 Feb 18 04:51 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Feb 18 04:52 script.gdb
-rw-r--r-- 1 root root 65861 Feb 18 05:37 server.log
-rw-r----- 1 root root 1 Feb 18 05:29 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r--r-- 1 root root 399 Feb 18 05:05 ssh_key
-rw-r----- 1 root root 65 Feb 18 05:34 status
drwxr-x--- 4 root root 4096 Feb 18 05:29 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Feb 18 04:50 sys
drwxrwxr-x 2 1000 1000 4096 Feb 18 04:52 test_output
drwxrwxrwt 1 root root 4096 Feb 18 05:51 tmp
drwxr-x--- 2 root root 4096 Feb 18 05:29 user_files
-rw-r----- 1 root root 1 Feb 18 05:33 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Feb 18 05:29 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2026-02-18 05:51:03,534 File /analyzer_tech_debt.txt with broken tests found
2026-02-18 05:51:03,535 File /broken_tests.json with broken tests found
2026-02-18 05:51:03,536 Broken tests in the list: 4
2026-02-18 05:51:03,536 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log
2026-02-18 05:51:03,579 Is flaky check: False
2026-02-18 05:51:03,579 Result parsed
2026-02-18 05:51:03,595 Result written
+ clickhouse-client -q 'system flush logs'
+ stop_logs_replication
+ echo 'Detach all logs replication'
Detach all logs replication
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Sent terminate signal to process with pid 619.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 619.
The process with pid = 619 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1511
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
API: SYSTEM.config
Time: 05:51:28 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ zstd --threads=0
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
API: SYSTEM.config
Time: 05:51:31 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:34 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:37 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:40 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:43 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:46 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:49 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:52 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
API: SYSTEM.config
Time: 05:51:55 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:51:58 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:01 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:04 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:07 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:10 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
API: SYSTEM.config
Time: 05:52:13 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:16 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:19 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:22 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:25 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:28 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:31 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:34 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:37 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:40 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:43 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
API: SYSTEM.config
Time: 05:52:46 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep SharedMergeTreePartCheckThread
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
API: SYSTEM.config
Time: 05:52:49 UTC 02/18/2026
DeploymentID: 8f643c08-202e-4c5b-9ffa-9b0f1f8e16f6
Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError)
4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf()
3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf()
2: cmd/logging.go:132:cmd.configLogOnceConsoleIf()
1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor()
+ rg -Fa ' received signal ' /test_output/gdb.log
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_5dfhvnsi.sql /var/lib/clickhouse/metadata/test_7r32u1m3_1.sql /var/lib/clickhouse/metadata/test_j1ln0elw.sql /var/lib/clickhouse/metadata/test.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ find . -type f -maxdepth 1 -name 'core.*'
+ read -r core